KEGG   Borrelia afzelii (Maryland): BafPKo_0215Help
Entry
BafPKo_0215       CDS       T02093                                 

Gene name
efp
Definition
(GenBank) translation elongation factor P
  KO
K02356  elongation factor P
Organism
bafz  Borrelia afzelii (Maryland)
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bafz03012]
    BafPKo_0215 (efp)
Translation factors [BR:bafz03012]
 Prokaryotic Type
  Elongation factors
   BafPKo_0215 (efp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Elong-fact-P_C EFP EFP_N
Motif
Other DBs
NCBI-ProteinID: AEL69442
UniProt: Q0SNU8
Position
complement(218385..218963)
Genome map
AA seq 192 aa AA seqDB search
MAVVKSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGAD
TAEAIEIYEASVQYLYKDKDVLVFMDLETYDQISLDLKENANFQDKVLFLQESEIYSLIM
FDNVVIDIKLAPKIAFEVVEVEAAVKGDTVTNAMKNITLNTGLIIKAPLFINVGDKVLVN
SETKEYAERIKN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagtgaaatctagcgagattgaaaaaggttcttttttacttattaaaggggct
ccccatattgttcttgaaagagaattttcaaaaacaggtaggggaggggcaatagtaagg
ttaaagcttaagaacttaaaaaacaaatttgtcattagagaaactttaaaaggtgcagat
actgcagaagcgattgaaatttatgaggctagtgttcagtatttatacaaagataaagac
gttttagttttcatggatttagaaacttatgatcaaattagtttggatttaaaagaaaat
gctaattttcaagataaagtgctttttttgcaggagtcagaaatttattctcttataatg
tttgacaatgtagttattgatattaagttggctccaaagattgcttttgaagttgtagag
gttgaggcagctgttaaaggtgacactgtaacaaatgcaatgaaaaatattactcttaat
acagggcttataataaaagcaccgctttttattaacgttggagataaagttttagttaat
tctgaaactaaagagtatgcagagcgaattaaaaattaa

DBGET integrated database retrieval system