KEGG   Borrelia afzelii (Maryland): BafPKo_0218Help
Entry
BafPKo_0218       CDS       T02093                                 

Definition
(GenBank) hypothetical protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEL69445
UniProt: G0IR59
Position
complement(220582..220803)
Genome map
AA seq 73 aa AA seqDB search
MGENRFFIKRGEPPPTINTATVSPIALPIANIVPARMPRLADGIIILYIVCQSVAANARD
ANLYDLGTALSDE
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaatagattttttataaaaagaggagaaccccctccaaccattaatactgct
actgtttctccaatagctcttcctattgctaatattgttcctgctagaatgccccgacta
gctgatggtattattattttatatattgtttgccagtctgttgctgctaatgcaagagat
gcaaatttatatgacttaggaacggctttaagcgatgagtag

DBGET integrated database retrieval system