KEGG   Borrelia afzelii (Maryland): BafPKo_0223Help
Entry
BafPKo_0223       CDS       T02093                                 

Definition
(GenBank) tRNA synthetases class II family protein
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz00970  Aminoacyl-tRNA biosynthesis
Module
bafz_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BafPKo_0223
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bafz01007]
    BafPKo_0223
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bafz03016]
    BafPKo_0223
Enzymes [BR:bafz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     BafPKo_0223
Amino acid related enzymes [BR:bafz01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   BafPKo_0223
Transfer RNA biogenesis [BR:bafz03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BafPKo_0223
 Prokaryotic Type
    BafPKo_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c tRNA_SAD Pfg27
Motif
Other DBs
NCBI-ProteinID: AEL69450
UniProt: Q0SNU2
Position
complement(224155..225939)
Genome map
AA seq 594 aa AA seqDB search
MTLDKLRKKYIDFFKSKKHFEIMGKSLVPENDPTVLFNTAGMQPLIPYLLGEVHPSGDML
VNVQKCLRTGDIDEVGDLSHLTFFEMLGNWSLGAYFKEYSVKCSFEFLTSSEYLNIPKDR
LYVSVFEGDQEIPRDTETAKVWESLGIPKDRIYYLSKDHNFWGPVGSKGPCGPDTEIYVD
TGKIKCSINCNVTCSCGKYFEIWNNVFMQYNKDENGNYMELDRKCVDTGMGLERTIAFLQ
GKSSVYDTDAFMPIIKRIEFISGKIYGQKEDDDRCIRIISDHIKAACFILADSSGVFPSN
LGQGYVLRRLIRRSIRYAKKLGIKSHFLADLVDSVETIYRSFYNELTEKKDFIKKELSTE
EEKFFKTLFQGEQEFIKITRNLSSKTIPGDIAFKLYDTYGFPYELTEELAFEYGFDIDKS
GFNEYFKKHQKTSKKGGDKVFKGGLADYTYETTKLHTATHLLHKALQLVLGDHVKQKGSN
ITAERLRFDFVHSKKMTDDEIKKVEDIVNLQIKNSLSVKKSIMELSEAREKGAMALFGEK
YDNLVSVYEIDGFSLEVCGGPHVENTNELGTFKIQKEQSSSSGIRRIKAILIDE
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgacaagttgcgtaaaaaatatattgatttttttaaatcaaaaaaacatttt
gaaataatgggtaaatcattggttcccgaaaatgatcctacggttctttttaatacagcc
ggcatgcagcctcttattccttatcttcttggagaagtgcatccatcaggagatatgctt
gttaatgttcaaaaatgcttgagaacaggcgatattgatgaggttggagatttaagccat
ttaactttttttgaaatgcttggaaattggtctcttggagcttattttaaagagtattct
gtaaagtgtagttttgaatttttaacgtcttctgagtatttaaatattccaaaagaccgt
ctttatgtgagtgtctttgaaggtgatcaagagattcctcgtgatacagagacggctaaa
gtttgggaaagtttaggtattcccaaagatagaatatattatctttctaaggatcataat
ttttgggggcctgttggatctaaaggaccttgtggaccagatactgaaatatatgtggat
actggaaagattaagtgttctattaactgcaatgttacgtgttcttgtggtaaatatttt
gaaatttggaataatgttttcatgcaatacaataaagatgaaaatggtaattatatggaa
ttggatcgaaaatgtgtcgatacgggaatggggcttgagaggacaattgctttcttgcag
ggcaagtcttcagtttatgatacagatgcatttatgcctataataaagagaatagaattt
atttctggtaaaatttatgggcaaaaagaagacgatgatagatgtattagaataatctct
gaccatattaaagcggcttgctttattcttgctgatagttctggtgttttcccttccaat
ttgggtcaaggatatgttttaagaaggctaataagacgatcgattagatatgcaaaaaag
cttggaataaagtcccattttttagctgatcttgttgattctgtagagactatttataga
tctttttataatgaattaacagaaaaaaaagattttatcaaaaaggaattgagtacagaa
gaagagaagttttttaaaactttatttcagggtgagcaagaatttattaaaataacacga
aatttgtcttctaagactatccctggtgatattgcttttaaactttatgatacttatggt
tttccatatgaattaacagaagagcttgcgtttgaatatggctttgatattgataaatcg
ggctttaatgagtattttaaaaagcatcaaaagacctcgaagaaagggggtgacaaagtc
tttaaaggaggccttgctgattatacttatgagactactaagttgcatacagcgactcat
ttgcttcacaaggcgcttcaattagtactaggtgatcatgttaagcaaaaaggaagcaat
attactgctgagcgattaaggtttgattttgttcattctaaaaagatgacagatgatgag
ataaaaaaagttgaagatattgttaatttacagataaaaaattctttatctgtaaaaaaa
tctataatggaattaagtgaagctcgagaaaaaggcgctatggctctttttggagaaaaa
tatgataatttggtgagcgtttatgagatagatggattttcacttgaagtttgtggaggc
cctcatgtagagaataccaatgaacttggtactttcaagatacaaaaagaacaatcctca
tcttcgggtataagaagaataaaagctattttgattgatgagtaa

DBGET integrated database retrieval system