KEGG   Borrelia afzelii (Maryland): BafPKo_0224Help
Entry
BafPKo_0224       CDS       T02093                                 

Definition
(GenBank) fliG C-terminal domain protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliG_N FliG_C FliG_M MgtE_N Peptidase_S49 Mor Phage_int_SAM_1
Motif
Other DBs
NCBI-ProteinID: AEL69451
UniProt: Q0SNU1
Position
complement(225939..227156)
Genome map
AA seq 405 aa AA seqDB search
MQDPRLSKYKNTKNLSKKTVEEIDTLSLNKNFSDSEIQGSMLRSWISLIKGNKNKTPIEF
KSNNINDLKPGFIRKESKVTKIAKYFLAIGLEKSAKIMSELDDSDIILITREISKINYIA
PEEKDRIIKEFEELLRNEKRYVKVDNNFAYDLLNKTLGKSKAKSIYKKVTGNDIFIPFDY
LSQIEHEQLWALIKDENIKTLVILYNYLNKDQKKYVFSMLGEEKRREFVKDLAKARQLSM
ETIEAISNKLKDRFKMQGRLKTDKLDGSKILVDILSYMDSNEEKNLLNKINMQDLNPAVD
NEIREKIFDINVILRIMDNDLHNILREFTDKEIAIIIKDKTDEVRDKMLSNVSKRRKEII
LDEEAFLGKISKKDLKTMTLFFINYIKNLTLKGDLTIYRKNEEFI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcctaggctttctaagtataaaaatactaaaaatttaagcaaaaaaactgtt
gaagaaattgatactttgagcttaaataaaaatttttccgattcagagattcaaggttct
atgcttagatcttggataagtcttattaaaggtaataaaaataaaacacctattgagttt
aaatccaataatattaatgatttaaagccagggtttattcgcaaagagagtaaggttaca
aagattgcaaaatattttttggctattgggcttgaaaaatctgcaaagattatgtctgag
cttgatgattcggatataatcttaattactagagaaatttcaaagattaattacattgct
ccagaagaaaaagatcgtattattaaagaatttgaagagttgctaagaaatgaaaaaagg
tatgttaaagttgataataactttgcttatgatttattgaataaaacgttaggaaaatct
aaagcaaaatcaatttataaaaaagttactggcaatgatatttttattccttttgattat
ttatctcaaattgagcatgaacaactttgggcattaattaaagatgaaaatattaaaacg
cttgtcatattatataattatttaaataaagatcaaaaaaagtatgttttttcaatgcta
ggagaagaaaagagaagagaattcgtaaaagatcttgctaaagcaaggcaattaagcatg
gagacaatagaggcaatttcaaataaacttaaggataggtttaagatgcaagggagactt
aagacagataaacttgacggatctaaaatacttgttgatattttaagctatatggattct
aatgaagagaaaaatctgcttaataaaattaatatgcaggatttaaatcctgctgtggac
aatgaaattcgagaaaaaatatttgatatcaatgtaatattgagaataatggataatgat
ttgcataatattttaagagagtttacagacaaagagattgcaattattattaaagataaa
actgatgaggttagagataaaatgctttcaaatgtttcaaaaaggcgcaaagaaattatt
ttagatgaggaagcttttttaggaaaaataagcaaaaaagatttaaaaaccatgacacta
ttttttattaattatattaaaaatttaactttaaaaggcgatttgacaatatatagaaaa
aatgaggaatttatttaa

DBGET integrated database retrieval system