KEGG   Borrelia afzelii (Maryland): BafPKo_0225Help
Entry
BafPKo_0225       CDS       T02093                                 

Gene name
pgl
Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz00030  Pentose phosphate pathway
bafz01100  Metabolic pathways
bafz01110  Biosynthesis of secondary metabolites
bafz01120  Microbial metabolism in diverse environments
bafz01130  Biosynthesis of antibiotics
bafz01200  Carbon metabolism
Module
bafz_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BafPKo_0225 (pgl)
Enzymes [BR:bafz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     BafPKo_0225 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: AEL69452
UniProt: Q0SNU0
Position
complement(227143..227850)
Genome map
AA seq 235 aa AA seqDB search
MEFLYSDEENNLKNRFFDFFNMNIDKDKYTSIGICGGRSIVTFLSVFLKQNFSFRRSHFF
LVDERCVPLNNEDSNYNLLNKNFFSKMVDENLISISKFHAFVYNEIDETTAIHDYNIEFN
SRFNIFDFILVSVGEDGHIASLFPSRKLLFSDVEGYQYEYNSPKFPTKRISLTPKSLFNA
KAVVLLFMGVDKKRALENFLSFNSSINECPARLLKEHPNLLVLTNIKRDEGYAGS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggagtttttatattctgatgaagagaataatttaaaaaatagattttttgattttttt
aatatgaatatagataaagataaatatacaagtattggaatttgtggcggtcgaagcata
gtcacttttttaagtgtttttcttaaacaaaatttttcttttagaagatcacattttttt
ttagttgatgaacggtgtgttccattaaataatgaggatagtaattataatcttttaaat
aagaattttttttccaaaatggttgatgaaaatttaataagcatttctaaatttcatgct
tttgtttataacgaaatagacgaaactacagctattcatgactataatattgaatttaat
tctaggtttaatatttttgattttattttagtttctgttggtgaggatggtcatatcgca
tcgctttttccttcaagaaaactgctgttttcagatgtagaaggttatcagtatgaatac
aattctcccaaatttcctactaaaagaataagcttgacgccaaaatctttgtttaatgca
aaagctgttgttttgttatttatgggcgttgataaaaagcgtgctttagaaaatttttta
agttttaatagttctatcaatgaatgtccagctagacttctcaaagagcatcccaattta
ttggttcttacaaatattaaaagagatgaaggttatgcaggatcctag

DBGET integrated database retrieval system