KEGG   Borrelia afzelii (Maryland): BafPKo_0238Help
Entry
BafPKo_0238       CDS       T02093                                 

Definition
(GenBank) NHL repeat family protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NHL TPR_11 TPR_2 TPR_1 ANAPC3 TPR_19 TPR_16 CCDC73
Motif
Other DBs
NCBI-ProteinID: AEL69465
UniProt: Q0SNS5
Position
complement(239424..241430)
Genome map
AA seq 668 aa AA seqDB search
MLIFGFVGLFFFNFFNLHAQGIVTNKDAQEEFKWALNSYNNGIYDDALLSFKKILSFDPN
NLDYHFWAGNVYYRLGYVEEALMEWRNLKDQGYKVPYLRHLISTIEQRRGIFSNYELKFK
KLVKVASLDNSIYKRPHGYQITSLRADKYGGYYAANFVGNEILYFDVNNNVNALVKDGFS
YLKSPYDVIEANDLLYVTLYSSDEIGVYDKVLGVKRRSIGKKGTKDGELLAPQYMAIDKR
NYIYVSEWGNKRVSKFGLEGDFILHFGYRTSGYKGLLGPTGVTYLNENIYVADSLRNTIE
VFDTSGNHLYSVFTSIEGIEGLSSDSVGNNVIVSSKDGVYKYNIAKKTITKILKADKLNS
KISSSILDANNQMIVSDFNNAKVSVYKSDSSLYDSLNVDVRRIVRLGGPKIYVELNVSSK
SGLPVVGLKSENFSIANENYYIVNPKVAYNVNASKDINIAVVFDKSSYMKNYDLDQIMGL
NTLIESSKNKNFSFINATNVPIIDNIESLTNSIKNTSSLGPYSTDTVKTDVSLKLAGSGL
MSKSSRRAVVYFSGGVLNRKAFEKYSLDTIVSYYKNNDIRFYLILFGNGLVDSKLQYLVD
ETGGAIIPFSSYEGVSKVYDLILEQKTGTYLLEYYYPGPQEPNKYFNLSVEVNINQQTGR
GEFAYFIN
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgttgatttttggttttgttggtttgtttttttttaatttttttaatttacatgctcaa
ggaatagttaccaataaagatgctcaagaagagtttaaatgggctcttaattcctataat
aatggaatttatgatgatgctcttttatcttttaaaaaaattttaagctttgatcctaat
aaccttgattatcatttttgggctggcaatgtttattatagactaggttatgttgaagaa
gctttaatggaatggagaaatttaaaagatcagggttataaggtcccttatcttaggcat
ttaatttctactattgagcaaaggagaggcattttttcaaattatgagcttaagtttaaa
aaacttgtaaaagttgcttctcttgataattctatttataaaaggccacatgggtatcag
attacatctttgagggctgataagtatggtggatattatgctgcaaactttgtaggtaat
gaaatattgtattttgatgttaataataatgttaatgctttagttaaagatggatttagt
tatttaaaatcaccttatgatgttattgaagccaatgatttgctttatgtgactctttat
tccagtgatgaaattggtgtttacgataaagttcttggagttaaaaggagatctattgga
aaaaaaggcacaaaagatggtgaattgcttgctcctcagtatatggctattgataagaga
aattatatttatgtgagtgagtggggaaataaaagagttagtaaatttggacttgagggt
gattttattttgcattttggttatagaacttcgggctacaagggtcttttaggccccaca
ggcgttacttatttgaatgaaaacatttatgttgcagattctctgagaaatactattgaa
gtttttgacactagtggcaatcatttgtattcagtttttacttctattgaaggaatagag
gggcttagtagtgattctgttggaaacaatgttatagtatcttcaaaagatggtgtttat
aagtacaatattgctaaaaagacaattacaaaaattttaaaagcagataaattgaattct
aaaatttcttcatctattttggatgccaataatcagatgattgtctcggattttaataat
gccaaggtttcagtttacaagagtgattcaagtctttatgacagtttaaatgttgatgtt
agaagaatagttagacttggggggcctaaaatttatgttgagcttaatgttagcagtaaa
agcgggttaccggttgttgggcttaagagtgaaaatttttcaattgcaaatgaaaattat
tacattgttaatcccaaggtagcgtacaatgtaaatgcttcaaaagatattaatatagca
gttgtttttgataaatcttcttatatgaaaaattatgatttagatcaaatcatgggttta
aatactttaatagagtcgtcaaaaaataaaaactttagttttataaatgcaacaaatgtg
cccattatagataatattgaaagcttgacaaatagcattaaaaacacaagttctcttggt
ccttatagtacagatactgtaaaaacagatgttagtttgaagttagcaggttctggactt
atgtcaaaaagctcaagaagagcagtagtttattttagtggtggtgttttaaatcgtaaa
gcttttgaaaagtactctttagatacaatagtaagctattataaaaataatgatataaga
ttttacttaatattatttggcaacggtcttgttgatagtaagcttcaatatttagttgat
gaaacaggcggtgctataattcctttttcatcttatgaaggagtgtctaaagtttatgat
ttaattttagaacaaaaaacgggtacttatttgttagaatattattatccaggccctcaa
gagcccaataaatattttaatttatctgttgaagtaaatatcaatcaacagactggaaga
ggggagtttgcatattttattaattag

DBGET integrated database retrieval system