KEGG   Borrelia afzelii (Maryland): BafPKo_0249Help
Entry
BafPKo_0249       CDS       T02093                                 

Gene name
pepF
Definition
(GenBank) oligoendopeptidase F
  KO
K08602  oligoendopeptidase F [EC:3.4.24.-]
Organism
bafz  Borrelia afzelii (Maryland)
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bafz01002]
    BafPKo_0249 (pepF)
Enzymes [BR:bafz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BafPKo_0249 (pepF)
Peptidases [BR:bafz01002]
 Metallo Peptidases
  Family M3
   BafPKo_0249 (pepF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M3 Peptidase_M3_N Peptidase_M78
Motif
Other DBs
NCBI-ProteinID: AEL69476
UniProt: Q0SNR3
Position
252318..254090
Genome map
AA seq 590 aa AA seqDB search
MTNRNEINENDKWDLSFLFANVEEYTKAINAIEIKTKEFKKYEKLELNFDLFKETLNKYY
EIMEDLEKVSYYAMLQLETDVTNKDSNKIYSTCVNIATKVSNTTSFLMPKILKTDAKKIQ
AWINAPELKEKKIAIEKILREKNHILSEQEEEILANYTPLYSSYQSIFSALTNADMEFGE
INGRPLTNSTYTLFLQNEDQKIRKEAFLKFYQKYKNNENTLANLIISDFKKNHFIAKTRK
FKNTFSMQLFSNNIDKKVYTNLIETVNENLSALNDYYDFRKKVLNQEYLYHYDVYVPLTK
GITFKNSFEEACEKILKSLEILGNEYTEILRNGLLKERWVDKYENTGKRSGAFSAGSYNG
KPYILLNYKEESIRDMFTLAHEAGHSMHSYFSIKNNPFPHYNYSIFEAEIASIINEQILA
EFLLKNETDTKKIKYIKLTQIDDMISTFFRQTMFAEFEYIIHEMISKEEPIVKETLTETY
MNLLKKYFGPSLKFDELSPLECLRIPHFYSPFYVYQYATGIAAALSIYKDIKENKKDAVA
NYIKFLKTGGSKYPLDSLNITGVDLTKKATIENTINIFKCRLEEIKKIFQ
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaatagaaatgaaatcaacgagaatgataaatgggatttatcctttctattcgca
aatgtagaagaatatacaaaagcaatcaatgctattgaaattaaaaccaaagaatttaaa
aaatatgaaaagttggaattaaattttgatttatttaaagaaactttaaacaaatattat
gaaattatggaagatttagaaaaggtctcctactatgcaatgcttcaattagaaacagat
gtaaccaacaaggattcaaataaaatatattctacatgtgttaatatagctacaaaggta
tctaatactacctcattcttaatgcccaaaatactaaaaacagatgcaaaaaaaattcaa
gcttggataaatgcacccgagcttaaggaaaaaaaaattgcaattgaaaaaatactaaga
gaaaaaaaccatattttaagcgaacaagaagaggaaatacttgccaactacacccctctt
tactcatcttatcaaagcatattctcagcattaacaaatgctgatatggaattcggagaa
attaatggacgccctttaaccaattccacttatacgctatttttacaaaacgaagatcaa
aaaatacgaaaagaagcttttttgaaattttatcaaaaatacaaaaacaatgagaataca
cttgccaatcttattatttcagactttaaaaaaaatcacttcattgcaaagacaagaaaa
tttaaaaatactttttcaatgcaactcttctcaaataacattgataaaaaagtctataca
aatttaatcgaaactgtcaatgaaaatttatctgcgcttaatgactattatgactttaga
aaaaaagttttaaaccaagaatatctatatcactacgatgtttacgtaccattaacaaaa
ggaataacattcaaaaattcatttgaagaagcttgtgaaaaaatattaaaatctttagaa
atattgggaaatgaatatacagaaatcttaagaaacggtcttttaaaagaaagatgggtt
gataaatacgagaatactggaaaaagatcgggagcctttagcgctggatcatacaacgga
aaaccttatatactccttaattacaaagaagaatcaataagagatatgtttacgcttgca
cacgaagcaggacattcaatgcactcttactttagcataaaaaacaatccatttccgcac
tataattattctatttttgaagcagaaatagcatcaataattaatgagcaaatattagca
gaatttttacttaaaaacgaaactgatactaaaaaaattaaatatataaaactaacacaa
attgacgatatgatttcaacattcttccgacaaacaatgtttgctgaatttgagtatatt
attcatgaaatgattagcaaagaagaacctatagtaaaagaaacactaacagaaacttat
atgaatttgctaaaaaaatactttggccctagtctaaaatttgatgaattaagtcccctt
gaatgccttaggattcctcacttttattcacccttttatgtgtaccagtatgctacaggc
attgcagccgctctatcaatatacaaagacattaaagaaaataaaaaagatgccgtagca
aattatataaaatttttaaaaacaggtggttctaaatatccattagattccttaaatatt
accggggtagatttaacaaaaaaagcaacaatagaaaacactataaacattttcaaatgt
agacttgaagagataaagaaaatattccaataa

DBGET integrated database retrieval system