KEGG   Borrelia afzelii (Maryland): BafPKo_0250Help
Entry
BafPKo_0250       CDS       T02093                                 

Definition
(GenBank) putative membrane protein
  KO
K01004  phosphatidylcholine synthase [EC:2.7.8.24]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz00564  Glycerophospholipid metabolism
bafz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BafPKo_0250
Enzymes [BR:bafz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.24  phosphatidylcholine synthase
     BafPKo_0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: AEL69477
UniProt: Q0SNR2
Position
254104..254808
Genome map
AA seq 234 aa AA seqDB search
MKNINLILAWLVHIFTASGLIVGLYSIISIINGDYSLLLKLIVIGLIIDGIDGTMARKLG
VKELIPEIDGTLLDNITDYINYTFIPVIFFYLGEFIEERYKVGIAIGILFSSAYQFSRTD
AKTNDNYFRGFPSLWNIFVILNIIFKIEQTTNLIMMSICIITSFIPIKFIYPSKTKELRK
ITIPLTIISCLIFVISIFSELSAEALKIAKTVLILYFAYLTLASIYLTYKTRNR
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatataaatttgattttagcttggcttgtacatatttttacagcatctggcttg
attgtgggactttactcaataatttcaattataaatggtgattattctcttcttttaaag
ttaatagtaataggacttataatagacggaattgatggaactatggcaagaaagcttggg
gtaaaagaattaatacctgaaattgatggcactctacttgacaacattacagactacata
aactatacattcatacccgttatatttttttatttaggagaattcattgaagaaagatat
aaagttggcattgcaattggaattctattctcatcagcataccaattctcaagaacagat
gcaaaaacaaatgataactactttagaggatttccttctctatggaatatctttgtaata
ttaaacataatctttaaaatagaacaaacaacaaatcttattatgatgtcaatatgcatt
attacaagctttatcccaataaaatttatttacccatcaaaaactaaagaattaaggaaa
atcaccataccattaacgataataagttgcctaatatttgttatatcaatattctcagag
ttatctgcagaagcattaaaaatagcaaaaaccgttctcattctttactttgcatattta
actttagcaagcatatatttaacctataaaacaagaaatagatga

DBGET integrated database retrieval system