KEGG   Borrelia afzelii (Maryland): BafPKo_0256Help
Entry
BafPKo_0256       CDS       T02093                                 

Gene name
recJ
Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz03410  Base excision repair
bafz03430  Mismatch repair
bafz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BafPKo_0256 (recJ)
   03430 Mismatch repair
    BafPKo_0256 (recJ)
   03440 Homologous recombination
    BafPKo_0256 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bafz03400]
    BafPKo_0256 (recJ)
Enzymes [BR:bafz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BafPKo_0256 (recJ)
DNA repair and recombination proteins [BR:bafz03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     BafPKo_0256 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BafPKo_0256 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BafPKo_0256 (recJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHA1 DHH
Motif
Other DBs
NCBI-ProteinID: AEL69482
UniProt: Q0SNQ7
Position
263137..265257
Genome map
AA seq 706 aa AA seqDB search
MKIWKQKEINIQAQELNRIVKQYNINPFEATLLIKREIKEEDFMFFLEDSVNLLHNPFLL
KNIDKFIKRINKAIKENENILIFGDKDADGITATIIMYETLKDFGLNVSYKIPSNGEFYG
LSNELINMALEKKISLIITVDNGISSIEEINYANSKGIEIIITDHHLPSEDFKTESIVIN
PHLKDDKYPFKEIAGCCVSFKTCLALSMSFTDLYSKNLVFLFLEKTKNEIILHAIEINNY
ILKQYLRLDYKNDPLINLNKLEKFVQNKYIIIFNKEDQDQLLNKHFTRNINTIDISENFI
KKYPNFRKKTLKDLIQATKYFKYKEVEIKEKLYYIFYNIIFETNKNLFQKCLKRLGFVAI
GTIADNMPIINENRIILKIGLKEIALRERMSINYLLKDAGILTKPNITSIDIAYKIAPIL
NSTGRLEKADIAINFLLTNDINQIENKFKEIKEINELRKYKEEKAWNSHNKNTIFKNDKF
IVCYDKNTPKGISSRIATRLSVYYQKVAIFLTKQGNIIKGSIRSNNKINSKTLISIIPSH
LVINSGGHKAAAGFTLHENLLEDFIKELEYATTKVDYETTNENESILIDAIIPKDLTKDS
LFKTIEIFEPYGYEFKEPILMMENAYLQELKIIDKNHSSKHINMRIKSQNDYYKAIFFNG
TKKIEELNIKEDQYLDIIFTVNEDFYCPRDKILKIIDIKKSAQTNV
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttggaaacaaaaagaaattaatatacaagcccaagaattaaatcgcattgtt
aagcaatataatatcaatccttttgaagcaactttgcttataaagcgagaaatcaaagaa
gaagattttatgtttttccttgaagacagcgtaaatttattacataacccgtttttatta
aaaaatatagataaatttataaaaagaattaataaagcaattaaagagaatgaaaacata
ttaatctttggagataaagatgctgatggaatcacagcaacaataataatgtatgaaact
cttaaagatttcggacttaatgtgagttataaaataccatcaaatggagaattttatgga
ctttcaaacgaattaatcaacatggctttagaaaaaaaaatctctttaataataactgtt
gataatggcatctctagtattgaagagataaattatgcaaattcaaaaggaatagaaata
ataatcacagaccaccatcttccaagcgaagattttaaaactgaaagcatagttataaat
cctcatctaaaagatgacaaatatccattcaaagaaatagcaggatgttgtgtaagtttt
aaaacttgtcttgctcttagcatgtcctttacagatctttactctaaaaaccttgtattt
ttatttttagaaaaaacaaaaaatgaaattattcttcatgcaatagaaataaacaactat
attttaaaacaatatctaagattagattataagaatgatcctttaattaatttaaacaaa
ctagaaaaatttgtacaaaataaatacataataatctttaacaaagaagatcaagatcaa
ttattaaataaacacttcacaagaaacataaatacaattgatattagtgaaaattttata
aaaaaatacccaaattttagaaaaaaaacattaaaagacttaatccaagcaactaaatat
tttaaatataaagaagttgagattaaagaaaagctttactacatattttacaacataatt
tttgaaactaacaaaaatttattccaaaaatgtctaaaaagacttggttttgttgcaata
ggaacaatagcagacaatatgcccattattaatgaaaacagaataatcctaaaaataggg
cttaaagaaattgcactaagagaaagaatgtctataaattacctattaaaagatgcaggc
atattaacaaaaccaaatataacttcaatagatatcgcatataaaattgcaccaatacta
aactcaacaggaaggcttgaaaaagcagatattgcaataaattttttactaactaacgac
attaatcaaatagaaaataaatttaaagaaataaaagaaatcaacgaactgagaaaatat
aaagaagaaaaagcttggaattcgcataataaaaatactatttttaaaaatgataaattt
atagtttgttatgataaaaacaccccaaaaggaataagttctagaattgcaactagactt
tctgtttactaccaaaaagttgctatttttttaacaaagcaaggtaatattattaaagga
tcaattagatcaaataataaaatcaattcaaaaacactaatatcgataataccttctcat
ttggtaataaattcggggggacataaagctgctgctggatttacactgcatgaaaatttg
ctcgaagactttattaaagaattagaatatgcaactacaaaagttgactatgaaactact
aatgaaaacgaatcaatattaatagatgctattattccaaaagatttaacaaaagattct
ctttttaaaacaatagaaatatttgagccttatggctatgaatttaaagagccaatatta
atgatggaaaatgcttaccttcaagaactcaaaataattgacaaaaatcatagctcaaaa
cacataaatatgcgcattaaatcacaaaacgattactataaagctattttttttaacgga
acaaaaaaaatagaagaattaaatataaaagaagatcaatatttagatatcatttttaca
gttaatgaagatttttactgcccgagagataaaattttaaaaattatcgacataaaaaag
agtgctcaaaccaatgtataa

DBGET integrated database retrieval system