KEGG   Borrelia afzelii (Maryland): BafPKo_0258Help
Entry
BafPKo_0258       CDS       T02093                                 

Gene name
rpsU
Definition
(GenBank) ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz03010  Ribosome
Module
bafz_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bafz00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BafPKo_0258 (rpsU)
Ribosome [BR:bafz03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BafPKo_0258 (rpsU)
  Bacteria
    BafPKo_0258 (rpsU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21
Motif
Other DBs
NCBI-ProteinID: AEL69484
UniProt: Q0SNQ5
Position
266209..266418
Genome map
AA seq 69 aa AA seqDB search
MVTVTVDKNENLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIRVKKEKAFKRKQAKKV
RKLKQKTNR
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
ttggtaacagtcactgtggataaaaatgaaaatcttgaaaaagcattaaaacgttttaaa
agaatgattgaaaaagaagcaattattcgcgaatggaagagaagagaatactatgaaaag
ccatccacaatccgcgtgaaaaaggaaaaagcttttaaacgaaaacaagcaaaaaaagtt
agaaaactaaaacaaaaaactaatagataa

DBGET integrated database retrieval system