KEGG   Borrelia afzelii (Maryland): BafPKo_0280Help
Entry
BafPKo_0280       CDS       T02093                                 

Gene name
fliM
Definition
(GenBank) flagellar motor switch protein FliM
  KO
K02416  flagellar motor switch protein FliM
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz02030  Bacterial chemotaxis
bafz02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BafPKo_0280 (fliM)
   02040 Flagellar assembly
    BafPKo_0280 (fliM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bafz02035]
    BafPKo_0280 (fliM)
Bacterial motility proteins [BR:bafz02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    BafPKo_0280 (fliM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliM FliMN_C
Motif
Other DBs
NCBI-ProteinID: AEL69506
UniProt: Q0SNN3
Position
complement(289090..290148)
Genome map
AA seq 352 aa AA seqDB search
MANNPGALSQDDIDSLLESINSSESLSLDESLSNVISSPTGKKQKVKVYDFKRPDKFSKE
QVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIINMDP
LKGSAIFEVDPTIAFAIVDRLFGGDGDTIKDKSRDLTEIEQSVMESVIIRILANMREAWS
QVVDLRPRFGHIEVNPQFAQIVPPTEMIILVTLEVKIGKVEGLMNFCLPYITIEPIVSKL
STRYWHSLIGVGTTSENLDALREKLENTAMPLVAEIGEVKLKVREILSLDKGDVLNLESS
LINKDLTLKVGTKEKFKCRMGLMGNKVSVQITEKIGDIKGFDLLKELTEEVE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaatccaggagctttatctcaggacgatatagatagtcttttagagtctatc
aactcatctgaaagtttatctttagatgaatctctttctaatgttatatctagtcctaca
ggcaaaaagcaaaaagttaaggtgtatgattttaaaaggccagataaattttcaaaagag
caggtcagaacagtttcaagttttcatgaggcatttgctaggtatactacaacctcactt
tctgctcttttgagaaaaatggttcatgttcatgtggcttcagttgaccaattaacctat
gaagagtttattaggtcaataccaaatcctacaactttagcaataattaacatggatcct
cttaaaggatctgctatttttgaagttgatccaaccatagcatttgctatagtagataga
ctttttgggggagatggagatacgattaaagataaaagtagggatttgacagaaatagag
cagtctgtaatggaaagtgttattattcgtatacttgctaatatgagagaggcttggtct
caagtagttgatctaaggccaagatttgggcatattgaggtcaatccacagtttgctcaa
atagttcctcctacagaaatgattattttagtaactcttgaggttaaaataggaaaagta
gaagggcttatgaatttttgtttaccttatattactatagaacctattgtttcaaaatta
tcaacaagatattggcattctttgattggagttggaaccactagtgagaatcttgatgct
ttgcgtgaaaagttggaaaatacagcgatgcctttggtggcagaaataggagaagttaag
cttaaagtaagggaaattttatcacttgacaaaggtgatgttttaaatcttgaatcttct
ctaataaataaagatttaactttgaaggttggcactaaagaaaaatttaaatgtagaatg
ggtttaatggggaataaagtttcagtacaaattacagaaaaaattggagatataaaaggt
tttgatttattaaaagagcttacagaagaggttgagtga

DBGET integrated database retrieval system