KEGG   Borrelia afzelii (Maryland): BafPKo_0281Help
Entry
BafPKo_0281       CDS       T02093                                 

Definition
(GenBank) flagellar basal body-associated FliL family protein
  KO
K02415  flagellar FliL protein
Organism
bafz  Borrelia afzelii (Maryland)
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bafz02035]
    BafPKo_0281
Bacterial motility proteins [BR:bafz02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BafPKo_0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliL Band_7 BEN
Motif
Other DBs
NCBI-ProteinID: AEL69507
UniProt: Q0SNN2
Position
complement(290169..290705)
Genome map
AA seq 178 aa AA seqDB search
MPNKDDENLDMGDSNVGRKGGLLPDIIIKILQILAIGIFTVAIMIIVSYFVSKMVVSQSG
APSDFPVFSNEYLGKPPMLIWYESIDEIRGNTLDVPPKTFVVKLALGYAENNVNILNELG
RQKVRLKDIIREYFSQRTGQEIKNESQIKAEIKARINSILRNGEIKEIALTQIDIFDM
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccaaataaggacgatgaaaatttagatatgggggattccaatgttggtagaaaaggt
ggtttattgcctgatattataataaaaattttacagatacttgcaataggaatatttact
gttgcgataatgataattgtttcttattttgtatctaaaatggtagtaagccaaagtggg
gctcctagtgattttccagttttttctaatgaatacttaggaaagccgcctatgcttata
tggtatgaaagcatagatgagattagaggcaatactttagatgttcctccaaaaactttt
gttgtaaaacttgctttagggtatgcggagaataatgttaatattcttaatgaacttgga
agacaaaaagtgcgattaaaagatattattagagaatattttagccaaagaaccggtcaa
gaaataaagaatgaaagtcaaataaaagcagaaatcaaggcaagaattaatagtattctt
agaaatggagaaataaaagaaatagcattaacccaaattgatatttttgatatgtaa

DBGET integrated database retrieval system