KEGG   Borrelia afzelii (Maryland): BafPKo_0283Help
Entry
BafPKo_0283       CDS       T02093                                 

Definition
(GenBank) motility protein A
  KO
K02556  chemotaxis protein MotA
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz02020  Two-component system
bafz02030  Bacterial chemotaxis
bafz02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BafPKo_0283
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BafPKo_0283
   02040 Flagellar assembly
    BafPKo_0283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bafz02000]
    BafPKo_0283
   02035 Bacterial motility proteins [BR:bafz02035]
    BafPKo_0283
Transporters [BR:bafz02000]
 Other Transporters
  Pores ion channels [TC:1]
   BafPKo_0283
Bacterial motility proteins [BR:bafz02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    BafPKo_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB
Motif
Other DBs
NCBI-ProteinID: AEL69509
UniProt: Q0SNN0
Position
complement(291535..292317)
Genome map
AA seq 260 aa AA seqDB search
MNLASIIGWGVGFGAILISMAFTPTGLGVFWDLSSVFITVVGSFSALMASSEVIAVKKIP
TYLGFFFRRNSHAKISIIKILVELSEKARKEGLLSLDDELEQINDPFFKSGMRLVVDGAD
PEVIRTMLYLELDQMQERHKVGSDLFKTWAKLAPAFGMTGTLIGLVALLGNLEDKSALGS
SMAVALITTLYGTIMANLMFIPVQLKLEKIDSEEAAVKTMIIEGVLSIQSGDNPRILEQK
LMTFLTPKDRSHLSSSIGGE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagctagtataattgggtggggagttggatttggagctattttaatttccatg
gcatttactcctacaggacttggtgttttttgggatttaagttctgtttttattactgtt
gttggatctttttctgctcttatggcttcttcagaagttattgctgtaaaaaaaattcca
acatatttaggatttttctttaggagaaattctcacgctaagatttctattataaaaata
ttagtagagctttcagaaaaggctagaaaagaaggtcttttatctcttgatgatgagctt
gaacaaattaatgatccattttttaagtcaggaatgaggcttgttgttgatggtgcagat
cccgaagtgattagaacgatgctttatttggagcttgatcaaatgcaagaaaggcataaa
gttggttcagatctttttaaaacttgggcaaaacttgctccggcttttggtatgacgggt
actcttattggacttgtagctcttcttggtaatctagaggacaagtctgcgcttggttct
tctatggctgttgcccttattacaactctttatggaactataatggcaaatttaatgttt
attcctgtccaacttaagctggaaaaaattgattctgaggaagctgcagtaaagacaatg
ataattgagggtgttttatcaattcagtctggagataatcctagaattttagagcaaaaa
ttgatgacgtttttaacccctaaagatcgaagtcatcttagtagtagtattgggggtgaa
taa

DBGET integrated database retrieval system