KEGG   Borrelia afzelii (Maryland): BafPKo_0289Help
Entry
BafPKo_0289       CDS       T02093                                 

Gene name
flbA
Definition
(GenBank) flagellar protein
  KO
K02382  flagellar protein FlbA
Organism
bafz  Borrelia afzelii (Maryland)
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bafz02035]
    BafPKo_0289 (flbA)
Bacterial motility proteins [BR:bafz02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BafPKo_0289 (flbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliJ
Motif
Other DBs
NCBI-ProteinID: AEL69515
UniProt: Q0SNM4
Position
complement(296151..296582)
Genome map
AA seq 143 aa AA seqDB search
MNDLNFRKQKLNRILTIRTYYRKLSERNLMNINKKISKINQFSDGIPNLLKSLNSFDDLS
IRGYIDCLNYKKKQNFKILGELRKHYNECYDIYVDKYREEKKIKILIKTLNNSIIKNREK
KESLLLDEYVNYKVCQDLRIESE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgatttaaactttagaaaacaaaagcttaatagaatattaaccattagaacctat
tatcgaaagttaagtgagagaaatttaatgaatataaataagaaaatttcaaaaataaat
cagttttcagatgggattcctaatcttttaaaaagcttaaatagttttgatgatctttcc
ataagaggttatatagactgtttaaattataaaaaaaaacaaaattttaaaattcttgga
gaacttagaaagcattataatgagtgttatgatatttatgtagataaatatagggaagaa
aaaaagattaaaatattaataaaaactttaaataattctataattaaaaatagagaaaag
aaggaaagcttattgctagatgagtatgtaaattataaagtttgtcaagatctgaggatt
gaaagtgaataa

DBGET integrated database retrieval system