KEGG   Borrelia afzelii (Maryland): BafPKo_0292Help
Entry
BafPKo_0292       CDS       T02093                                 

Gene name
fliG
Definition
(GenBank) flagellar motor switch protein FliG
  KO
K02410  flagellar motor switch protein FliG
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz02030  Bacterial chemotaxis
bafz02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BafPKo_0292 (fliG)
   02040 Flagellar assembly
    BafPKo_0292 (fliG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bafz02035]
    BafPKo_0292 (fliG)
Bacterial motility proteins [BR:bafz02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    BafPKo_0292 (fliG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliG_C FliG_N FliG_M MgtE_N DUF1908
Motif
Other DBs
NCBI-ProteinID: AEL69518
UniProt: Q0SNM1
Position
complement(298843..299877)
Genome map
AA seq 344 aa AA seqDB search
MEEKKEKEILDVSALTGKQKAAILLVSIGSEISSKVFKYLSQEEIESLTFEIAKLETITS
ELKDNVLLEFKELMMAQEFIQKGGIDYARELLEKSLGTQKAVDIINNLGSALQSRPFEFV
RRADPANILNFIQQEHPQTIALILSYLDPQKASFILSSLPTEVQTNVARRIALMDRTSPE
VVREVERVLEKKLASLSSEDYTSAGGVDNVVEIINMADRKTEKFIIESLEEEDPELAEEI
KKKMFVFEDIVLLDDRSIQRVLREIDGQELAKALKSVDIPVQEKIFKNMSKRAASMLKED
MEFLGPTRRKDVEESQQKIVSLIRKLEEQGEIVISRGGEEDVLV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaaaagaaaaggagattcttgatgtttctgctttaacaggtaagcaaaag
gccgctattttgctggtttcaataggttctgaaatctcttctaaagtgtttaagtatctt
tctcaagaagagatagagtctttaacatttgagatagcaaagcttgagacaattacttct
gagcttaaggataatgttcttttagagtttaaagaattaatgatggctcaagaatttatt
caaaagggtggaattgattatgcaagagagcttcttgaaaagtctcttggaactcaaaaa
gcagttgacattattaataatttgggatctgctttacagtctaggccttttgaatttgtc
agaagagcagatcctgcaaatattttaaactttattcaacaagaacatccccaaacaatt
gctttaatactttcttatcttgatccccaaaaggcttcttttattctctctagtttgcct
acagaggtgcaaaccaatgttgcaaggagaattgcgttaatggatagaacttctcctgaa
gtcgtaagagaggtcgagagagttcttgagaaaaaactagcttctctttcttcagaagat
tacacatcagcaggaggagttgacaatgttgttgagataattaatatggctgatagaaag
acagaaaagtttattattgaatctcttgaagaagaagatccagagcttgcagaagagatt
aagaagaaaatgtttgtatttgaggatatagttttgcttgatgacagatctatacaaaga
gtcttaagagaaatagatggtcaagagttggcaaaagctttaaaatctgtagatattcct
gtccaagaaaaaattttcaaaaacatgtcaaaaagagcagcttcaatgcttaaggaggat
atggaatttttggggcctactaggcgaaaagatgttgaagaatcccagcaaaaaattgtt
tctcttattagaaaattagaagaacagggagaaatagttatttcaagaggtggcgaggaa
gatgtgcttgtctga

DBGET integrated database retrieval system