KEGG   Borrelia afzelii (Maryland): BafPKo_0306Help
Entry
BafPKo_0306       CDS       T02093                                 

Gene name
murF
Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase family protein
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz00300  Lysine biosynthesis
bafz00550  Peptidoglycan biosynthesis
bafz01100  Metabolic pathways
bafz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BafPKo_0306 (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BafPKo_0306 (murF)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BafPKo_0306 (murF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bafz01011]
    BafPKo_0306 (murF)
Enzymes [BR:bafz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     BafPKo_0306 (murF)
Peptidoglycan biosynthesis and degradation proteins [BR:bafz01011]
 Precursor biosynthesis
  Amino acid ligase
   BafPKo_0306 (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AEL69532
UniProt: Q0SNK6
Position
complement(311845..313236)
Genome map
AA seq 463 aa AA seqDB search
MRIKIKDILISSKDVKFVGNIKNIEKVVSFYSLDSREINDNNINGSLYFAYKGNKVDGFS
FVKYLIDLGVKCFICSRDHESECIEYLNDNEGLVFLLTSNVIKLLQTLASFLIKRTSFKR
IAITGSNGKTTTKEILYSILSKKYKTYKTWGNLNSDIGLPLSILRVEGNEEYAVFEVGIS
YVGEMDLLSQILKPEIVIITNISYAHMQAFRGLQAIAFEKSKIIGKNIEIFVVNEMNDYC
VYLEKRAKIANPNVKIVYFDYENLNIKSFSFSEGKFSYDFVYKGFEYSILLLGRHNIFNA
IGCINLALFLGMREKEIREGLIETTFQKGRAEILTKNGYLILNDSYNGNMGSFMALKNMI
LDLNIQNKKFIVLGSFKELGEFAYKTHKDLIQEAVSMNFDKIFLIGEEFLDVRDSENLVG
KYLYYFSEFDKFIDFFLKSLEPSVFIVIKGSRFNRLERILNYI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtataaagattaaagatattttaatctcttctaaagatgtgaagtttgtagggaat
ataaaaaatattgaaaaagtagtgtcattttactctctagatagtcgcgaaataaatgat
aataatattaacggtagtctttattttgcatataagggaaataaagtagatggattttct
tttgttaaatatttaattgatttgggtgttaaatgttttatatgttcaagagatcatgaa
tctgagtgtattgaatatttaaatgataatgaagggttggtttttttacttacaagcaat
gtaataaaacttcttcaaactttagcatcgtttttaattaaaaggacaagctttaaaaga
attgctattacgggcagtaatggcaaaactacaaccaaagaaatactttatagtatactt
tcaaagaaatataaaacttacaaaacttggggtaatttaaattctgacattgggcttcct
cttagtattttaagggtagaaggtaatgaagaatatgctgtttttgaagttggaattagt
tatgttggagaaatggatcttttatcccaaattttaaaacccgaaattgttattattacg
aatataagttatgcacatatgcaagctttcagggggttacaagctattgcttttgagaaa
agcaaaataattggcaaaaatattgaaatctttgttgtaaatgaaatgaatgattattgt
gtttatcttgaaaaaagagcaaaaatcgcaaatccaaatgttaaaatcgtttattttgat
tatgaaaatcttaatattaaatcattttctttttcggaagggaaattttcttatgatttt
gtttacaaagggtttgagtactctattttattgttaggtcggcataatatttttaatgca
ataggttgtattaatttggccctatttttgggaatgagagaaaaagaaataagagaaggg
cttattgaaaccacttttcaaaagggtagggcagaaattttgacaaaaaatggatactta
attttaaatgattcttataatggcaatatgggttcttttatggccttaaaaaatatgatt
ttggaccttaatatccaaaataaaaaatttatagttcttgggtcttttaaagagcttggg
gaatttgcgtacaaaactcacaaagatttaatccaagaggctgtttcaatgaattttgat
aaaatttttttaattggcgaagaatttttagatgttagggattctgagaatttagttgga
aagtatttatattattttagtgagtttgataaatttattgatttttttttaaaaagtttg
gaaccttcagtttttattgttattaagggctcaaggttcaacagattagagagaatttta
aattatatttag

DBGET integrated database retrieval system