KEGG   Borrelia afzelii (Maryland): BafPKo_0320Help
Entry
BafPKo_0320       CDS       T02093                                 

Definition
(GenBank) basic membrane family protein
  KO
K02058  simple sugar transport system substrate-binding protein
Organism
bafz  Borrelia afzelii (Maryland)
Module
bafz_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bafz02000]
    BafPKo_0320
Transporters [BR:bafz02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    BafPKo_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bmp Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AEL69546
UniProt: G0IRN6
Position
complement(324391..325440)
Genome map
AA seq 349 aa AA seqDB search
MSKNVFFKGFWILFTIFHLYLFVYLIFFKRQKVDISNKTNIAFFVPGVISGSPSYKEMYD
SLFEFKKKHDNLEIKVLEAGFNQSEWIEMLEKLLTSKKYDFLITTNNAMQDIVDSVSNDY
PYTKFLIFDSLVKNVNNQVYSVSYNVAEEAYILGYYVGLFLKEFNSGLGNVALIAGQEYP
VMRDYIYYYFKKGILDVGVNSEVYYRVLGNWHDSNLAKLLSDSLIQNSGVFVILPIVGPA
VEGVLSSIRDNNIFAVLFDSEDYLDNKENIIGSGITNQKYYVSYILDKALNSEISYGNSD
IFGIKHKGVLFNISNVFYLEQTSQKLKEDLFKKIEEVSANGIKINLEQN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaacgtgttttttaaagggttttggattttattcacgatatttcatttgtat
ttatttgtttatttgattttttttaaaaggcaaaaggttgatatttctaataaaacgaat
attgctttctttgttccaggagttatttcaggatctccatcttataaagaaatgtatgat
tctttgtttgaatttaaaaaaaagcatgacaatcttgaaattaaagttttagaggctgga
tttaatcaaagtgagtggatagaaatgcttgaaaaattattaacttcaaaaaaatatgat
tttttaataaccacaaataatgctatgcaagatattgttgatagtgtttcgaatgattat
ccttatactaagtttctaatttttgattctttagtcaaaaacgtcaacaatcaagtttat
tcagtttcttataatgttgcagaggaggcatatattttagggtattatgtgggtcttttt
ttaaaggaatttaattctggcctagggaatgttgccctgattgcgggtcaagaatatcct
gttatgagagattatatttattattatttcaaaaaaggcattcttgatgtgggtgtgaat
tctgaagtttattatcgagttttgggcaattggcatgatagtaatttggctaaattgttg
tcagactctttgattcaaaattcgggtgtttttgtaatacttcctattgtaggtcctgct
gttgaaggagtactttcctctattagagataataatatttttgcggttctttttgatagt
gaagattatctagataataaagaaaatattattggttcaggaattacaaatcaaaaatat
tatgtttcatatattttagataaggcgcttaactcagagattagctatgggaattctgat
atttttggaataaaacataagggagttttgtttaatatttctaatgttttttatttagag
caaaccagtcaaaagttgaaagaagatctttttaaaaaaatagaagaggttagtgcaaat
ggtataaaaattaatttggaacaaaattaa

DBGET integrated database retrieval system