KEGG   Borrelia afzelii (Maryland): BafPKo_0325Help
Entry
BafPKo_0325       CDS       T02093                                 

Definition
(GenBank) tetratricopeptide repeat family protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_6 TPR_19 SRP_TPR_like TPR_8 TPR_1 Foie-gras_1 YfiO DUF4810 TPR_21 ANAPC3 YtzH Cas_Csa5
Motif
Other DBs
NCBI-ProteinID: AEL69551
UniProt: Q0SNI8
Position
328415..328780
Genome map
AA seq 121 aa AA seqDB search
MKKLILLNLLLISCYTINLDKLTKETPYGVYLREAQKAVNVNDYNSALKAYEKMIQNFAH
NPNIVATGKYEIAFIYYTTNKTEKAKKIFKELIENKMEMPKWIKPLAKKILNKIENNNLK
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactaatattattaaacttattacttatttcatgctatacaattaatttagac
aaattaacaaaagaaactccttatggagtttatctcagagaagcccaaaaggctgtcaat
gttaatgattacaactctgcattaaaagcatacgaaaaaatgattcaaaatttcgctcac
aatccaaatatagttgctactggcaaatatgaaattgcatttatatattacacaacaaac
aaaacagaaaaagcaaaaaaaatatttaaagagctaatagaaaataagatggaaatgcct
aaatggattaagcctttggctaaaaaaatattaaataaaatagaaaataataatttaaaa
aaataa

DBGET integrated database retrieval system