KEGG   Bacillus coagulans 36D1: Bcoa_0394Help
Entry
Bcoa_0394         CDS       T01628                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00620  Pyruvate metabolism
bag00630  Glyoxylate and dicarboxylate metabolism
bag01100  Metabolic pathways
bag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcoa_0394
   00630 Glyoxylate and dicarboxylate metabolism
    Bcoa_0394
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     Bcoa_0394
    1.2.1.22  lactaldehyde dehydrogenase
     Bcoa_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA Wtap DUF1487 LuxC
Motif
Other DBs
NCBI-ProteinID: AEO99617
UniProt: G2TP14
Position
complement(394711..396159)
Genome map
AA seq 482 aa AA seqDB search
MKTATKTYQMYIDGEFTDAASKETSQVINPATEEVISEVPKATIEDVRRAIDAAERAQKS
WEKCPSSERAKYLTAIAQEIRRNADALARVISEEVGKTLELSTTEVHFTADYIDYMAGWA
RRYEGEIVPSDRPKENIFVYKAPIGVIAGILPWNFPFFLIARKAAPALITGNTIVIKPSG
ESPNNALEFAKIIDKIGLPKGVINIVTGSGSTLGDELSRNPKVGMVSLTGSYSAGAAVMR
AAADNITKVSLELGGKAPTIVMDDADIDLAVKSVVESRVINTGQVCNCTERVYVQESVAD
VFISKIVKAMQDVKFGDPLAEEGLDMGPLVSKSALESVDQMVKRAVEGGAKVLTGGKPAG
RDKGYYYEPTVLVNVDNTMEIMREEIFGPVLPIATFKTLDEAIELANDCQYGLTSAIFTS
NVDTMMRASNELKFGETYVNRESFEAIQGFHAGWRKSGVGGADGKHGLEEYLQTHVVYVQ
YK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggctacaaaaacataccaaatgtatattgacggggaatttacagacgctgct
tcaaaagaaacttcccaagttataaacccggcaacagaagaagtgatttccgaagtcccg
aaagcaacaatcgaggatgtcagaagggcaatcgatgcggcagaacgtgcccagaaatca
tgggaaaaatgtccttcttctgaacgggccaaatacttaactgcgatagcacaggaaatc
cgccgcaacgccgatgctttggcgcgcgtcatttcagaagaagtcggaaaaacgctggaa
ctttccacaaccgaagtccattttacagccgattatatcgactacatggccggctgggcg
cggcggtacgaaggggaaatcgtgccaagcgaccgcccgaaagaaaacattttcgtctac
aaagcccccattggcgtcattgctggcattttgccatggaacttcccgtttttcctcatc
gcccgtaaagcagcgccggcgctgattaccggaaatacgattgtgatcaaaccgagcggg
gaatcgccgaacaatgcgttggaatttgcaaaaatcattgacaaaatcggcctgccgaaa
ggggttatcaatattgtcacaggcagcggaagcacgctcggggatgaactgtcccgcaac
ccgaaagttggcatggtcagccttaccggcagttacagtgcaggagcggccgtgatgcgg
gcagccgcggacaatattacaaaagtttcgcttgaattaggcgggaaagccccgacgatt
gtgatggacgatgccgatatcgatcttgctgtcaaatcggttgttgaatcgcgtgtgatc
aataccgggcaggtttgcaactgcacagaacgcgtatatgttcaagaaagtgtcgcagat
gtgtttatcagcaaaatcgtcaaagccatgcaggacgtcaaattcggtgacccgcttgcc
gaagaagggctggatatggggccgcttgtcagcaaaagcgcactggaaagcgtcgatcaa
atggtgaaaagagcggttgaaggcggcgccaaagtgttaaccggcggcaaaccggctggc
agggacaaaggctactattatgagccgaccgtgcttgtcaatgtcgataacacaatggaa
atcatgcgcgaggaaattttcgggccggttctcccgattgcgacgtttaaaacacttgat
gaggcgattgaactggcaaatgactgccaatacggcctgacttctgccattttcacttcc
aatgtagacacaatgatgcgtgccagcaatgaattgaagtttggcgaaacgtatgtgaac
cgtgaaagctttgaagcgatccagggcttccacgccggctggagaaaatcgggcgtcggc
ggtgcagacggcaaacacggcctcgaagaatacttgcaaacgcatgttgtatatgtacaa
tacaaataa

DBGET integrated database retrieval system