KEGG   Bacillus coagulans 36D1: Bcoa_1580Help
Entry
Bcoa_1580         CDS       T01628                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00071  Fatty acid degradation
bag00072  Synthesis and degradation of ketone bodies
bag00280  Valine, leucine and isoleucine degradation
bag00310  Lysine degradation
bag00362  Benzoate degradation
bag00380  Tryptophan metabolism
bag00620  Pyruvate metabolism
bag00630  Glyoxylate and dicarboxylate metabolism
bag00640  Propanoate metabolism
bag00650  Butanoate metabolism
bag00900  Terpenoid backbone biosynthesis
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
bag01212  Fatty acid metabolism
bag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcoa_1580
   00630 Glyoxylate and dicarboxylate metabolism
    Bcoa_1580
   00640 Propanoate metabolism
    Bcoa_1580
   00650 Butanoate metabolism
    Bcoa_1580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcoa_1580
   00072 Synthesis and degradation of ketone bodies
    Bcoa_1580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcoa_1580
   00310 Lysine degradation
    Bcoa_1580
   00380 Tryptophan metabolism
    Bcoa_1580
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcoa_1580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcoa_1580
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcoa_1580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bag04147]
    Bcoa_1580
Enzymes [BR:bag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcoa_1580
Exosome [BR:bag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcoa_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD Dodecin Histone_HNS
Motif
Other DBs
NCBI-ProteinID: AEP00781
UniProt: G2TJ18
Position
1704737..1705912
Genome map
AA seq 391 aa AA seqDB search
MTDIVLLEGARTPFTELSGSLREITATDLGAIAAKEAIKKSNISAEEIDHVVFGNVQQSS
KDAHLLARHVGLKAGTPIDVPAITINRLCGTGIEAIVTAARYILTGEAEVVLAGGTENMS
QVPHVIRGMRWGSPLGSPKVEDWLWDGLYDTYGDCTMAQTAENLAAKYGITREEIDQHAL
SSHERAKRAREKGYLQEEIVPVTVKGRKGDIVVKDDEHIRDTSMEQLARLKPRFIENGVV
TAGNASGMVDGAGAVVVASSDYAGQKGLKPIARLVSWNVVGVEPKYMGIGPVPAIRNALK
KAKLTISDLNLIEINEAFSAQYLACQKELGFDLEMGNVNGGAIALGHPLAASGTRITTAL
IYEMRRRKQKYGASAVCIGGGQGIAAVWEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgtactgcttgaaggcgcaagaacgccgtttacagagctttcgggttca
ttgcgcgaaatcacggccaccgatctgggggcgattgcggcaaaagaagccattaaaaaa
tcgaatatttcagctgaagaaattgaccatgtcgtcttcggcaatgtacagcaatcgagc
aaagatgcccatttgctcgcaaggcatgtcggcttgaaggcaggaacgccgattgatgtg
cccgctattacgattaaccggctgtgcgggacggggattgaagcgatcgtaacagcggcg
cgttatattttaaccggggaagcggaagtcgttcttgccggaggaacggaaaatatgagt
caggtgccgcatgtcattcggggcatgcgctggggcagcccgctcggttccccgaaagtg
gaggactggctgtgggacggtctgtatgatacatacggggactgcacgatggcacaaacg
gccgagaacctggcggcaaaatacgggattacgagagaagaaatcgaccagcatgccctt
tccagccacgaacgggcgaaacgggcacgggaaaaggggtacttgcaggaagagattgtg
ccggtgacggtaaaagggcggaaaggggacattgtcgtgaaagacgatgaacatatccgc
gacacgagcatggagcagctcgcccggctgaaaccgagattcatagaaaacggcgtggtc
acagcagggaatgcaagcgggatggtggacggcgccggtgcagtggtagtggcatcaagc
gactatgcggggcaaaaaggcttaaagcccattgcccgccttgtgtcctggaacgttgtc
ggcgtggagccgaaatatatggggattggcccggttccggcaatccgaaacgctttaaag
aaagcaaagcttacgataagtgatctaaatttaattgaaatcaatgaagccttctctgca
cagtatttggcgtgccagaaagaactcggttttgatcttgagatggggaatgtgaacggc
ggtgcgattgcgctcgggcacccgcttgcagcaagcggcacgaggatcaccactgccctg
atatatgaaatgcgcaggcgaaaacaaaagtacggtgcttccgccgtgtgcatcggcggc
gggcaaggaatcgcagcagtttgggaagccttgtaa

DBGET integrated database retrieval system