KEGG   Bacillus coagulans 36D1: Bcoa_1666Help
Entry
Bcoa_1666         CDS       T01628                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00010  Glycolysis / Gluconeogenesis
bag00071  Fatty acid degradation
bag00350  Tyrosine metabolism
bag00625  Chloroalkane and chloroalkene degradation
bag00626  Naphthalene degradation
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_1666
  Lipid metabolism
   00071 Fatty acid degradation
    Bcoa_1666
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcoa_1666
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcoa_1666
   00626 Naphthalene degradation
    Bcoa_1666
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcoa_1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_31 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEP00861
UniProt: G2TJ98
Position
1800991..1802013
Genome map
AA seq 340 aa AA seqDB search
MRAAVVSSDKQKLVEVKDVQLRPLEYGEALVDIEYCGVCHTDLHVAKGDFGDVPGRILGH
EGVGIVREVADGVTSLKVGDRVSVAWFFEGCGHCEYCLTGNETFCRDVKNAGYSIDGAMA
EQCIVKADYAVKVPEGLDPRQATSITCAGVTTYKAIKVADVKPGEWIAIYGAGGLGNLAV
QYAKHVFNAKVIAIDINDDKLSLAKEVGADLTFNSKMKGDPAEWIQKEVGGAHAAVVTAV
SKQAFNQAVHSVRPVSKVVAVGLPPETMDLEIVKTVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTRRLEEVGDVFKEMEEGRIQGRMVLDMSLK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagtcgtcagttctgataagcaaaaactggtagaggtcaaagatgtgcag
ttgcgtccacttgaatatggggaagctttggtggatatcgaatactgcggtgtctgccat
acggatctgcatgtggcaaagggcgactttggcgatgtgccgggacgcattctcggccat
gaaggagtcggcattgtcagggaagtcgcggatggtgtcacttctcttaaagtgggcgat
cgtgtaagcgttgcctggttttttgaaggctgcgggcattgtgagtactgtttaacggga
aatgaaacattttgccgtgatgtgaaaaatgcaggctacagtatcgacggagcaatggca
gagcagtgcatcgtcaaagcggattacgccgtaaaagtgccggaagggctggatccaagg
caggcgacgagcattacttgcgcaggtgtcaccacttataaagccattaaagtcgcagat
gtgaagccgggcgaatggattgccatttatggagccggcggtcttggtaaccttgctgtc
cagtacgccaaacatgtatttaatgcgaaagtcattgcgatcgatatcaatgacgacaaa
ctttcactggcaaaagaagtcggtgctgatctcacctttaattccaaaatgaaaggcgat
ccggctgaatggatccaaaaagaagttggcggcgcgcatgctgcagtggtaacggctgtt
tcaaaacaggcttttaaccaggctgtccactctgtacggccggtttcaaaagtcgttgct
gtcgggctccctccggaaacaatggatcttgaaattgtgaagacggttcttgacggaata
gaagtcgtcggctctttggtaggcacgagaaaagaccttgaggaagcttttatgttcggt
gcggaaggaaaagtcgtcccggttgtgcaaacgcgcagactggaagaagttggagatgtt
tttaaggaaatggaagaaggcagaatacaaggcaggatggttctggatatgtcgttgaaa
taa

DBGET integrated database retrieval system