KEGG   Bacillus coagulans 36D1: Bcoa_2433Help
Entry
Bcoa_2433         CDS       T01628                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00300  Lysine biosynthesis
bag01100  Metabolic pathways
bag01120  Microbial metabolism in diverse environments
bag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bcoa_2433
Enzymes [BR:bag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bcoa_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEP01611
UniProt: G2TNA2
Position
2655562..2656980
Genome map
AA seq 472 aa AA seqDB search
MADIHWMEEVLKRKEDLIRDLQGILQIRSVLDEANATEEAPLGQGVREALQYMLDLGEKD
GFKTKNVQNLAGHLEMGEGEDILGILGHVDVVPEGDGWTVDPYSGIVKDGKIYARGSSDD
KGPTMAAYYGMKIVKELGVPLEKRVRLIVGTDEESNWRCMDAYFANEEMPAIGFSPDADF
PIIYAEKGIADFDIIQDPEKTENTGQAELLSFESGRRYNMVPDYAEARIVTHGEQTELLQ
KFQDFQKETGLRGQDFVDDGVLILKLEGVSAHGAEPENGKSAGLYLAKFLNNVALDRAGA
KFIKTLNQFFGRSRGEYFGIGYKDEVSGELTINIGIMSYHQEKGGRIGLNMRYPVTFDLE
AGKTKIVSKLKEDGLRFDHFSDQKPHYVDKNDPLITTLAKVYEEQTGEEAKLLAIGGGTY
ARTLKKGVAFGALFPGREDVMHQKDEYMYVEDLLKATAIYAQSIYELAGKHA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatccactggatggaagaagtattaaaaaggaaagaggatttgatccgcgac
cttcaagggattttgcagatcagaagtgtcctcgatgaagcaaatgcaacagaagaagca
ccactcgggcaaggcgtcagggaggcactccaatatatgctcgatctcggtgaaaaagac
ggtttcaaaacgaaaaatgtgcaaaatctcgccgggcaccttgaaatgggggaaggagaa
gacattctcgggatcctcgggcatgtcgatgtggtgccggagggggacggctggacagtt
gatccgtacagcggcatagtcaaagacgggaaaatttatgcacgcggctcaagcgacgac
aaaggcccgacaatggcggcttattacggcatgaaaattgtaaaagaactcggggtgccg
cttgaaaaaagggtgcgcctcattgtcggcacagatgaagaaagcaactggagatgcatg
gacgcctattttgcaaacgaggaaatgccggccatcgggttttcgccggatgccgacttc
ccaattatttacgcagaaaaaggaattgccgattttgacatcatccaggatccggaaaaa
acggaaaatacggggcaggcggaactgctttcttttgaatcggggcgccgctacaatatg
gtgccagattatgcggaggcacgcattgtcacgcacggcgagcagacggaacttttgcaa
aaattccaggattttcaaaaggaaaccggacttcgcgggcaggattttgtggacgacggc
gttttgattttaaaactggaaggcgtttcggcccatggtgcggaaccggaaaacggaaaa
agcgcggggctttatttggcaaaatttttaaataatgtggcgcttgaccgtgccggggca
aaatttatcaaaacgctcaaccagttcttcggccgttcacgcggtgaatatttcggcatc
gggtacaaagatgaagtttcaggggaattgacgatcaatatcgggatcatgtcctatcat
caggaaaaaggcggccgcataggattaaatatgcgttatcccgttactttcgatctcgaa
gcaggaaaaacaaaaattgtgtcgaaattaaaagaagacggcttgcgttttgatcatttt
tccgatcagaaaccgcattatgttgacaaaaatgacccgctgattacgacgcttgcgaaa
gtgtatgaggagcagaccggagaggaagcgaagctgttggcaatcggcggcggtacatat
gcacgtacccttaaaaaaggtgtggcatttggggcgcttttcccgggccgcgaagatgtc
atgcaccagaaagatgagtacatgtatgtggaagatttgcttaaagcaacggctatttat
gcacagtccatttatgaactggccgggaagcacgcgtga

DBGET integrated database retrieval system