KEGG   Bacillus coagulans 36D1: Bcoa_2494Help
Entry
Bcoa_2494         CDS       T01628                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00010  Glycolysis / Gluconeogenesis
bag00620  Pyruvate metabolism
bag00640  Propanoate metabolism
bag00680  Methane metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_2494
   00620 Pyruvate metabolism
    Bcoa_2494
   00640 Propanoate metabolism
    Bcoa_2494
  Energy metabolism
   00680 Methane metabolism
    Bcoa_2494
Enzymes [BR:bag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcoa_2494
Lipid biosynthesis proteins [BR:bag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcoa_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEP01672
UniProt: G2TPE3
Position
2722488..2724062
Genome map
AA seq 524 aa AA seqDB search
MRRSDLIAPQTYNIAEEIEKYARDPHKVALIWEDKEGMHREVTYKELIENANRTGHVFLE
SGLKKGDTILVMVPRIVEAYEVYLAAMKCGIVLLPASEMLRTKDLDYRIEAGDVKGVVAH
YSCTEQFKEVRGIDHLKKFVIGEPEQGWAFLDEKKKAAPCELEIAKTSKDDIAILSYTSG
TTGNPKGVIHTHSWGYAHLRTAAPNWLGIQKGDRVWATAAPGWQKWVWSPFLSVLGSGAI
GFVYNGRFDPEKYLSLLDEYEINVLCCTPTEYRLMAKVDDLSQYHLKSLRSAVSAGEPLN
REVIDVFQNHFGITIRDGYGQTESTLLVGYSLDTPLRPGSMGKPFPGNEVEIVNDDGKPC
KLGETGDIAVHRDTPALFKGYYKEPERTAKQYRGDYFITGDRARKDEDGYFWFEGRRDDI
IISSGYTIGPFEVEDALVKHPYVKECAVVASPHEIRGSIVKAFVVLKDGISENLPGLVKE
LQNHVKQLTAPYKYPRAIEFIKELPKTASGKIRRVELRQQEWNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtcgtagtgacctgattgcgccacaaacatacaatatagccgaagaaattgagaaa
tatgcccgggacccgcacaaagttgcgctgatttgggaagacaaagaaggcatgcacaga
gaagtcacatataaagaattaattgaaaatgcaaaccggaccggccatgtctttttggaa
agcgggctgaaaaagggagataccatacttgtcatggttccgcgtattgtagaagcatac
gaagtgtatctcgctgcaatgaaatgcggcatcgttcttttgccagcctcggaaatgctg
cggacaaaagacctcgactaccggatcgaagcaggggatgtaaaaggcgttgtcgcccat
tattcatgcaccgaacagtttaaagaagtccgcggcattgatcatttgaaaaaattcgtg
atcggagaaccggaacagggatgggcgtttctggatgaaaagaaaaaagcagccccttgt
gaactggaaatcgccaaaacgtcaaaagatgatatcgccattttgtcttacacttccggg
acaaccggcaatccaaaaggcgtcatccatacgcacagctggggatacgcccatttgcgc
acggctgccccgaactggcttggcattcagaaaggcgaccgcgtttgggcgacggccgca
ccgggatggcaaaaatgggtgtggagtccgttcctttccgtgctcggttcaggcgcaatc
gggtttgtttacaacggccgttttgaccctgaaaaatatttgtcccttttggatgaatat
gaaatcaatgtgctctgctgcacaccgactgaataccgtttaatggcaaaagtcgatgat
ttgtcccagtatcatctgaaaagcttaaggagcgcggtctcagccggagaaccgctgaac
cgcgaagtcatcgatgttttccaaaaccatttcggcatcacgatccgtgacggttacgga
cagacggaaagcacgctgctcgtcggttattcccttgatacgccgttgcgcccgggttca
atgggcaaaccgttccccgggaatgaagtcgaaatcgtaaatgatgacgggaagccgtgc
aaactgggcgaaactggcgatattgccgtccatagagacacgcctgcgctttttaaaggc
tattataaagagccggagcgtacggccaagcaataccgcggcgattacttcataacaggg
gacagggcaagaaaagacgaggacggttatttctggtttgaaggcaggcgggatgatatc
attatttcttccggctatacgatcgggccgtttgaagtcgaagatgcccttgtcaagcat
ccgtatgtgaaagaatgtgccgttgtcgcaagcccgcacgaaatccgcggcagcattgtg
aaagcttttgtcgttttaaaagacggcatcagcgagaatttgccggggcttgtaaaagaa
ctgcaaaaccatgtgaaacaactgaccgcgccgtacaaatatccgcgtgcaattgaattt
atcaaggaattgccaaaaacggcctccggcaaaattcgccgtgtcgagctcaggcagcag
gaatggaatagataa

DBGET integrated database retrieval system