KEGG   Bacillus coagulans 36D1: Bcoa_2809Help
Entry
Bcoa_2809         CDS       T01628                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00010  Glycolysis / Gluconeogenesis
bag00052  Galactose metabolism
bag00500  Starch and sucrose metabolism
bag00520  Amino sugar and nucleotide sugar metabolism
bag00521  Streptomycin biosynthesis
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
Module
bag_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bag_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_2809
   00052 Galactose metabolism
    Bcoa_2809
   00500 Starch and sucrose metabolism
    Bcoa_2809
   00520 Amino sugar and nucleotide sugar metabolism
    Bcoa_2809
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcoa_2809
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bcoa_2809
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bcoa_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEP01985
UniProt: G2TPM3
Position
3036737..3037705
Genome map
AA seq 322 aa AA seqDB search
MAEKWIIGIDLGGTTTKLAFVNEAGDILHRWEIPTVTANQGEAILPNIAKSIEDELARVK
REKKDITGIGLGVPGPVDMEAGVIYETVNIGWAQHYPAAGTLQKWTGLKVVIDNDANVAA
LGEMWKGAGKGSGEMVFVTLGTGVGGGIITGGDIVHGVKGAAGEIGHITVIPEGGAKCNC
GKTGCLETVASATGVVRTAMAKLAAFSSASPLKDLYAQSGSVTAKDVFDFAKAGDALSCE
IVDETAKYLGLALASVANTLNPEKIVLGGGVSKAGETLLNPVRAYFLKYAFNTVGKSTKL
ELATLGNDAGVLGAAWLALNKI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaatggatcattggcattgatttggggggcaccaccacaaaactggcattt
gtgaatgaagcaggcgatattttacacagatgggagatcccgactgtgacggctaaccag
ggggaagcgatccttccgaatatcgcaaaatcgattgaggacgaattggcccgggtaaag
cgggagaaaaaagatatcacagggatcggcctcggcgtaccgggaccggttgatatggaa
gccggcgtgatctatgaaaccgtcaatatcggctgggcacagcattatccggctgccggg
acattgcaaaaatggacggggttaaaagtggtgatcgataatgatgcaaacgttgcggca
ctcggtgaaatgtggaagggtgccgggaaaggttccggggaaatggtcttcgttacgctt
ggcaccggtgtcggcggcggcatcattacaggcggcgacatcgtccacggtgtaaaaggg
gcggcaggcgaaattggccatattaccgttattccggaaggcggggcaaagtgtaactgc
gggaaaaccggctgccttgaaacggtcgcttctgcaacaggcgtggtcaggacagccatg
gcgaaactggctgcatttagcagcgcgtctccgttaaaagatttgtatgcccaaagcggc
tcggtaaccgctaaagatgtgtttgattttgcgaaagcgggcgatgccctttcctgtgaa
attgtggacgaaacggcaaaatacctcgggcttgcgctggcaagtgtggcaaatacgtta
aatccggaaaaaatcgtgttagggggcggggtgtcaaaagcaggcgaaacgctcttaaac
ccagtgcgcgcttattttttgaaatacgcgttcaacacggtcggcaaatcgacaaaactg
gaacttgccacattgggaaacgatgctggcgtgctcggggcagcgtggttggcgttaaat
aaaatataa

DBGET integrated database retrieval system