KEGG   Bacillus coagulans 36D1: Bcoa_3294Help
Entry
Bcoa_3294         CDS       T01628                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00670  One carbon pool by folate
bag01100  Metabolic pathways
bag01120  Microbial metabolism in diverse environments
bag01200  Carbon metabolism
Module
bag_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Bcoa_3294
Enzymes [BR:bag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Bcoa_3294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AEP02466
UniProt: G2TMG8
Position
complement(3495498..3497183)
Genome map
AA seq 561 aa AA seqDB search
MPSHSIGKTDIDIAQHASLKPIKEIAETVQLAEEDLEYYGKYKAKITYEKIKQLKTKKDG
KLFLVTSINPTPAGEGKSTVTIGLGDALKQLGHKTVIALREPSLGPVMGLKGGATGGGYA
QVLPMEEINLHFTGDFHAITAANNAISALLDNHIHQGNRLQIDQRRIVWKRAVDLNDRAL
RHVVVGLGGPGQGVPREDGFDITVASELMAVLCLAEDLEDLKRRIANIVVAYNYEKKPVT
VGDLGIEGAIALLLKDALKPNLVQTIEHTPALVHGGPFANIAHGCNSVMATKTALKLADY
VVTEAGFGADLGAEKFLDIKARAAGLKPDGVVIVATIRALKMHGGVSKEDLAAENIAALE
AGLLNLQKHVETIASFGLPFVVAINRFISDSDAEIAVLENWCSERGIPVSLTEVWEKGGA
GGIDLAAKLLEAAKQPHTFRPVYPLESTIEEKIEAIVRQVYGGRGAEFSAKAQKQIREFE
QFGWGHLPVCIAKTQYSLSDDPHKTCRPYDFAIHVRELVPKLGAGFIVALTGDVLTMPGL
PKEPAAYRMDVDADGRASGLF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
ttgccaagccattcgattggaaagacggatattgatattgcacagcatgcttcgctgaaa
ccgatcaaagaaattgcggaaaccgtgcagcttgcagaagaagaccttgaatattacggg
aaatacaaggcgaaaattacatatgaaaaaatcaagcagcttaaaaccaaaaaagacgga
aaattatttcttgtcacttccatcaatccgacgccggctggggaaggcaagtcaaccgtc
acaatcggactcggcgatgcattaaaacagctgggccataaaaccgtgattgccttaagg
gagccatcactcggaccggtcatggggctgaaagggggcgcaacgggcggcggttatgca
caagtcttgccgatggaagagatcaatcttcatttcacaggcgattttcatgcgattacc
gctgccaataatgccatttccgctttgctggacaatcatatccaccagggaaatcgattg
cagattgaccagcgccgcattgtctggaagcgggcggtcgatttaaatgaccgggcgctg
cgccatgtggtcgtcggtctcggcggtcccggccagggcgtgccccgtgaagacggattt
gacattacggtggcttctgaactgatggccgttttatgcctggcggaagatctcgaagat
ttaaaaaggcggattgcgaacatcgttgtagcctacaattacgaaaagaaacccgtgacc
gtcggtgacctcggaatcgaaggcgcgattgccttattgctgaaagatgctttgaaaccg
aatcttgtccagacgatcgaacatacaccggcgcttgtccacggtggcccgtttgccaat
attgcgcacggctgcaacagcgtgatggcgaccaaaaccgctttgaaactggccgattat
gtcgtcacggaagccggctttggtgccgatctcggtgctgaaaaattcctcgacattaaa
gcgcgggcagccggcttgaaaccggacggcgttgtgattgtcgccaccatccgcgcatta
aaaatgcacggcggggtgtcaaaggaagatttggcggcagaaaatattgcggctcttgaa
gccgggcttttaaacctgcaaaaacatgttgaaacgatcgcttcattcggtctgccgttt
gtcgttgccatcaaccggtttatatcggacagtgatgcggaaattgctgtcttagaaaat
tggtgcagtgaacgtggcattcctgtgtcgcttacggaagtgtgggaaaaagggggcgca
ggtggcatagatcttgcggccaaactgctggaagccgccaaacagccacatacattcagg
ccggtttacccgcttgaatcaaccattgaagagaagatagaggcgattgtgcgtcaggtg
tatggcggccgcggtgccgaattttccgcgaaggcgcaaaaacaaatccgcgaatttgaa
caattcggatggggacatcttcctgtttgtattgcaaaaacgcagtattccttatccgat
gacccgcacaaaacgtgccgtccgtatgattttgcgatccatgtccgcgaacttgtcccg
aagcttggcgccgggtttatcgttgccctgacaggagacgttctgaccatgccgggtctt
ccgaaagaaccggccgcttaccggatggatgttgatgcggacggtcgcgcatccgggctc
ttttaa

DBGET integrated database retrieval system