KEGG   Brevibacillus agri: BA6348_12290Help
Entry
BA6348_12290      CDS       T05855                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bagr  Brevibacillus agri
Pathway
bagr00030  Pentose phosphate pathway
bagr00480  Glutathione metabolism
bagr01100  Metabolic pathways
bagr01110  Biosynthesis of secondary metabolites
bagr01120  Microbial metabolism in diverse environments
bagr01130  Biosynthesis of antibiotics
bagr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bagr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BA6348_12290
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BA6348_12290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bagr04147]
    BA6348_12290
Enzymes [BR:bagr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BA6348_12290
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BA6348_12290
Exosome [BR:bagr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BA6348_12290
  Exosomal proteins of colorectal cancer cells
   BA6348_12290
  Exosomal proteins of bladder cancer cells
   BA6348_12290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N DUF969
Motif
Other DBs
NCBI-ProteinID: QAV13461
Position
2455550..2457049
Genome map
AA seq 499 aa AA seqDB search
MEPMSFVLFGATGDLAKRKIFPALFNLYVDKKLPAAFSIVGVGRRAWSDTAFIQSVEQSI
REFSRRHEIDQAVLAPFLAAFSYVAVDVTDAAGYASLLERVEQREKEFNLPQNRMFYLSV
APEYFEVIAANIQESGLGSPQGWKRLIIEKPFGRDLQSAEDLNQKLTKAFTEEEIYRIDH
YLGKAMVQNLEALEFANPVFAALWNNRHIANVQITASETVGVEERAGFYEQAGALRDMVQ
NHMLQMLMMVAMHIPKRITATDIRAQKRKVMEAVRPLKIEEVAQNVVRAQYSAGQIGETP
VVGYRDEPGVSPASMTETYIAARVWIDDPFWRGVPFYIRTGKRLKEKATRIVIEFKNPLE
RLYREQQEKTLPNLLIINVHPEEGIALQLNSKNPANSGKIEPVTVDFSAGHQDVPEAYER
LLFDALRGDSTYFAHWNEVRLSWKWVEPILAAFERNLVPLVSYEAGSHGPEAARDLLREE
GFSWWLDHVEERELEPVHR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgatgagctttgtcctttttggtgctacaggagatttggcgaaacgcaaaatt
tttccggcgttgtttaatttatatgtcgataaaaagctgcctgctgccttttccattgtc
ggagtgggcaggagagcatggtctgatacggcgtttatccaaagtgtagagcagtccatc
cgggagttttcccgtcgccacgagatcgaccaggcggtgcttgcaccatttttggcggcg
ttctcgtatgtggcagtcgatgtgacggatgctgcgggatacgcgtcgttgcttgagcgg
gtggagcagcgggaaaaggagttcaacctcccgcaaaaccggatgttttatttgtcggtg
gcgcccgagtattttgaagtgattgcggccaacatccaggagagcggactcggctctcca
cagggctggaagcgcctgattatcgaaaagccgtttgggcgcgacctgcaatcggccgaa
gacttgaatcagaagctgacgaaagcttttaccgaagaagaaatttaccgcatcgatcat
tatttgggcaaggccatggtgcaaaatctggaggcgctggagttcgccaaccctgtgttt
gccgcgctgtggaacaatcggcacatcgcaaacgtgcagattacagccagcgagacggtc
ggagtggaagaaagggcaggcttttacgagcaggccggagcactccgcgacatggtgcaa
aaccacatgctgcaaatgctgatgatggtcgccatgcacatccccaagcggattacggca
accgatattcgggcacaaaagcgcaaggtgatggaggcagtgcggccgctgaaaatagaa
gaggtggcgcaaaacgtcgtgcgcgcccagtacagtgccgggcaaatcggggagacgcct
gttgttggctaccgggacgagccgggggtatcgcctgcgtccatgacggaaacgtatatc
gcagcgcgcgtttggatcgacgacccgttttggagaggcgtgcctttttacattcgcaca
ggaaagcggctgaaggaaaaagcgacccgcatcgtcatcgaattcaaaaaccctttggag
cggctgtaccgggagcagcaagaaaagacattgcccaacctgctcatcatcaacgtccat
cccgaagaaggaatcgccttgcagttgaatagtaagaatccggccaatagcggaaaaatt
gagcctgtcacggttgacttcagcgcaggccaccaggacgtgccagaggcgtacgaacga
ctgctgttcgatgcgctgcgcggcgattccacttacttcgcccactggaacgaagtgcgg
ctgtcgtggaaatgggtggagccgatccttgccgccttcgaacgcaatctcgttccgctc
gtctcgtatgaggcaggttcacacggtccggaggccgcgcgtgatttgcttcgggaagaa
ggattttcctggtggctagatcatgtagaagaacgtgagctggagccagtgcatcggtag

DBGET integrated database retrieval system