KEGG   Brevibacillus agri: BA6348_16410Help
Entry
BA6348_16410      CDS       T05855                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bagr  Brevibacillus agri
Brite
KEGG Orthology (KO) [BR:bagr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bagr03009]
    BA6348_16410
Enzymes [BR:bagr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BA6348_16410
Ribosome biogenesis [BR:bagr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BA6348_16410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: QAV14204
Position
complement(3360214..3361122)
Genome map
AA seq 302 aa AA seqDB search
MRSMKKEGEWLVARLQADDDAIPIGNLLREVWKLPRKQVHLLFQHKEVLVDGAPVAQHVP
VREGQEIRLRMCPPEPLGLAPASESLQVLYEDDHLLIVNKPSGMLLHPTEPHHHLTLDHL
VSGHFFRTGLQAKVRHVHRLDQDTSGVVLYAKHAWASALLDEMLRERKIKRTYIAFVSGQ
MAKGSGKINEPIGKDRYHATRRRVAPNGDPAITHYEVKERYKTATKVECRLETGRTHQIR
VHMSHLGHPLLGDELYGGKRDLVKRQALHAAVLTLAHPFGGEAVEAYAPLPLDLLALEKK
LR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcgatgaaaaaggaaggagaatggctcgttgcccgcttgcaggcggacgacgac
gccatcccgatcgggaacctgctgcgcgaggtgtggaagttgccgcgcaagcaggtccat
cttttgtttcagcataaagaagtgctcgtagacggcgcacctgtcgcccagcatgtgccg
gtaagagaggggcaagagattcgcctgcgaatgtgtccgccggagccgctggggcttgcg
cctgccagcgagtcgctgcaagtgttgtatgaagacgaccatctgttaatcgtaaacaag
ccttcgggcatgctgttgcatccaaccgagccgcaccatcatctgacgctggaccatctg
gtgtcggggcattttttccggacggggttgcaagcgaaggtgcgccacgtccacaggctc
gatcaggatacgtccggggtggtgctgtacgccaagcacgcctgggcgtctgccttgctg
gacgaaatgctgcgcgaacgcaaaatcaagcggacgtatatcgccttcgtctcggggcaa
atggccaagggcagcggaaagatcaacgagccaatcggcaaggacaggtatcatgcgaca
cgcagacgagtggctccaaacggcgaccccgcgatcacccattacgaggtcaaggagcgc
tacaagaccgcgacaaaggtggagtgcaggctggagacgggacggacgcaccagattcgc
gtccacatgagccatctcggccatccgctgctcggcgacgagctgtacggcggcaagcgc
gatctggtcaaaagacaggcgctgcacgcggccgttctcacgcttgcgcatccgtttgga
ggcgaagccgtggaagcgtacgcgccgcttccgctcgatctgctcgccttggaaaagaag
ctgcgataa

DBGET integrated database retrieval system