KEGG   Brevibacillus agri: BA6348_23700Help
Entry
BA6348_23700      CDS       T05855                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bagr  Brevibacillus agri
Pathway
bagr00860  Porphyrin and chlorophyll metabolism
bagr01100  Metabolic pathways
bagr01110  Biosynthesis of secondary metabolites
bagr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bagr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BA6348_23700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bagr01007]
    BA6348_23700
Enzymes [BR:bagr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BA6348_23700
Amino acid related enzymes [BR:bagr01007]
 Aminotransferase (transaminase)
  Class III
   BA6348_23700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: QAV15492
Position
4838934..4840226
Genome map
AA seq 430 aa AA seqDB search
MKRERSALLHEQAMDVILGGVNSPSRSFKAVGGGAPVTMERAQGAYFWDVDGNRYIDYLA
AYGPIITGHAHPHVTKAICEAAANGTLYGTPTPWEVTFANMIREAIPSMERIRFNNSGTE
SVMTCIRVARAYTGRVKIIKFAGCYHGHSDLVLVAAGSGPSTLGIPDSAGIPQSIANEVI
TVPFNDIGAFAEAMSKWGSETACVLVEPIVGNFGIVTPEPGFLEEVNRIAHEAGALVVYD
EVITAFRFCYGGAQNLLGVTPDLTALGKIIGGGLPIGAYGGRRDIMEQVAPLGPAYQAGT
MAGNPASIRAGIACLEVLKQPGVYDEFERLGALLEKGIRDAASKHGVTIQLNRVKGAMAV
YFTDEPVRDYDAAQKADGELFARFFRLLLDEGICLAPSKYEAWFITTAHTEDDIRETIAA
VDRAFAQLNA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaacgatccgcgctgctgcacgaacaagccatggatgtcattctcggtggg
gtaaacagcccttcccgttctttcaaggccgtaggcgggggagcgcccgtgacgatggag
cgtgcccagggcgcgtatttctgggacgtggacggcaaccgatatattgactatttggcg
gcgtatggcccgatcattacaggccacgcccatccgcatgtaaccaaagcgatctgcgaa
gcggcggcgaacggcacgctgtacgggacgccgactccgtgggaagtaacttttgccaac
atgatccgcgaagcgatcccgtcgatggagcgcatccgcttcaacaactccggtacggaa
tccgtcatgacgtgcattcgcgtggctcgtgcctacaccggacgcgtgaaaatcatcaaa
ttcgcgggctgctaccacgggcactccgatctcgtgctcgtcgcggcaggctctggacct
tccacgctgggcatcccggacagcgccggcattccgcaaagcatcgccaacgaagtgatt
accgttccgttcaacgacatcggcgcgtttgccgaagcgatgagcaagtggggtagcgaa
acagcgtgcgtgctggtcgagccgatcgtcggcaacttcggtatcgtcacgccggagcca
ggctttttggaagaagtaaaccgcatcgcgcacgaagcaggtgcgctcgttgtgtacgac
gaggttattaccgcattccgcttctgctacggcggggcgcaaaacttgctgggtgtaaca
cctgacctgaccgcgctcggaaaaatcatcggcggcggcttgccgattggcgcgtatggc
ggacgccgcgatattatggagcaggtcgcgccgctcggtccagcctaccaggcagggaca
atggcgggcaatcccgcttccatccgcgccggaatcgcttgcctggaagtgctgaagcag
cctggcgtgtacgatgagttcgagcgactcggtgcgcttttggaaaaaggcattcgcgac
gcggcgagcaagcacggcgtcaccattcagctcaaccgcgtcaaaggagctatggcggtt
tactttacggacgagccagtccgcgactacgatgccgcgcaaaaagccgatggcgagctg
ttcgcccgcttcttccgcctccttttggacgaaggcatctgcctcgcgccttccaaatac
gaggcgtggttcatcaccaccgctcacacggaggacgacatccgggaaacgattgcggct
gtcgaccgcgccttcgcccagttgaacgcgtag

DBGET integrated database retrieval system