KEGG   Bacillus anthracis CDC 684: BAMEG_4097
Entry
BAMEG_4097        CDS       T00886                                 

Symbol
pfl
Name
(GenBank) formate C-acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00620  Pyruvate metabolism
bah00640  Propanoate metabolism
bah00650  Butanoate metabolism
bah01100  Metabolic pathways
bah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAMEG_4097 (pfl)
   00640 Propanoate metabolism
    BAMEG_4097 (pfl)
   00650 Butanoate metabolism
    BAMEG_4097 (pfl)
Enzymes [BR:bah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BAMEG_4097 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACP12542
Position
complement(3733368..3735617)
AA seq 749 aa
MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLAGATEATKQLWDQVMD
LTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDKPFKRSLQPYGGIRMAE
QACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKSGVITGLPDAYGRGRIIG
DYRRVALYGVDHLIEAKKADLNLTGGVMSEDTMRLREELSEQIRALQELKQMAASHGFDI
SKPATNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDIYIERDLANGTLTEEDVQEI
VDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALDGRPLVTKNSFRFLHTLDNLG
PAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYENDDIMRADYGDDYGIACCVSAMRI
GKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYAPITSEVLDYEEVMHKFDMTMEW
LAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTMATGIAGLSVVADSLSAIKYAKVK
PIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLVKTFMNKLRKHKTYRNSVHTMSILT
ITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRDTKGALASLLSVAKLPYEDAQDGISN
TFSIIPKALGKEDEVQVRNLVSMLDGYAVKEGHHLNINVFNRETLMDAMEHPEKYPQLTI
RVSGYAVNFIKLTREQQIDVINRTMHESM
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgactcaagtattagaaaatgttaaaaacgcatgggaaaactttaaaggtgaaaaatgg
aaagcagagattgatgttcgcgatttcattttaaataatgtaaacgtttacgagggagat
gaatctttcttagcgggagcaactgaagcaacgaaacaactttgggatcaagtaatggat
ttaacaacgaaagaacgtgaaaacggtggcgttcttgatatggatacaaaaattgtttct
tctattacatcacatgaaccaggatatttaaataaagagactgaaaaagtagtcggtttc
caaactgataaaccatttaaacgttctttacagccatatggtggtattcgtatggcggaa
caagcttgtgaatcttatggatacgaaatggataaagaacttagtcgtatttttagagat
tggagaaaaactcataaccaaggtgtatttgatgcttatacaccagaaatgagagctgct
cgtaaatcaggtgttattactggtcttccagatgcatacggacgtggacgtattatcggt
gactaccgccgcgtagcattatatggagtagatcatttaattgaagcgaagaaagcagat
ttaaatttaactggcggtgtaatgagtgaagatacaatgcgtttacgcgaagaattatct
gagcaaatacgtgcacttcaagagttaaaacaaatggctgcttctcatggatttgatatt
tctaagccagcaacaaatgctcaagaagcattccaatggttatactttgcatatcttgca
gcaattaaagagcaaaacggagctgcaatgagtcttggacgtacttctacattcttagat
atttatattgaaagagatttagcaaatggtactttaacagaagaagacgtacaagaaatt
gtggatcacttcattatgaaattacgtcttgtgaaatttgccagaacacctgattataat
gagttattctctggtgacccaacttgggtaactgagtctatcggtggtatggcattagat
ggtcgtccattagtaacaaagaactcattccgtttcttgcatacattagataatttagga
ccagctccagaaccaaacttaacagttctttggtctaaacaattaccacagaactttaaa
aactactgtgcgaaaatgtctattaaaacatcagcaattcaatatgaaaatgatgacatt
atgcgtgctgactacggcgatgactacggaattgcttgttgtgtatctgcaatgagaatc
ggtaaacaaatgcaattctttggcgcacgtgcaaacttagcaaaagcattgctatatgcg
attaacggtggtaaagatgaaaaatctaaagcgcaagttggtcctgagtatgcaccgatt
acttctgaagtattagattatgaagaagttatgcataagtttgatatgacaatggaatgg
ttagcgggtctatatttaaacacattaaatgttattcactacatgcacgataaatatagc
tacgaacgtattgaaatggcacttcatgatacaaatgttcttcgtacaatggcaacaggt
atcgcgggtctatctgtagtagcagattctttaagtgcaattaaatatgcaaaagtaaaa
ccaattcgcgatgaaaacggaatcgcagttgactttgaaattgaaggagatttccctaaa
tacggtaacaatgatgaccgtgtagatgaaattgctgtaaatcttgtgaaaacatttatg
aataaacttcgtaaacataaaacatacagaaattctgttcatacaatgtcaatcttaaca
atcacatctaacgttgtatacggtaagaaaactggtaacactccagatggtcgccgtact
ggagaaccatttgcaccaggtgcgaacccaatgcatggacgtgatacaaaaggtgcgcta
gcttcattattatctgtagctaaattaccatatgaagatgcacaagatggtatttctaat
acattctctattattccaaaagcacttggtaaagaggatgaagtacaagtacgtaactta
gtatcaatgcttgatggttatgcagtaaaagaaggacatcacttaaatattaacgtattt
aaccgtgaaacattaatggatgcaatggaacatcctgagaaatatccacaattaacaatt
cgcgtatctggttacgctgtaaactttattaaattaactcgtgaacaacaaatcgatgta
attaaccgtacaatgcatgaaagcatgtaa

DBGET integrated database retrieval system