KEGG   Bacillus anthracis CDC 684: BAMEG_0755Help
Entry
BAMEG_0755        CDS       T00886                                 

Definition
(GenBank) putative phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00010  Glycolysis / Gluconeogenesis
bah00260  Glycine, serine and threonine metabolism
bah00680  Methane metabolism
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01200  Carbon metabolism
bah01230  Biosynthesis of amino acids
Module
bah_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bah_M00002  Glycolysis, core module involving three-carbon compounds
bah_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMEG_0755
  Energy metabolism
   00680 Methane metabolism
    BAMEG_0755
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAMEG_0755
Enzymes [BR:bah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAMEG_0755
Membrane trafficking [BR:bah04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BAMEG_0755
Exosome [BR:bah04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAMEG_0755
  Exosomal proteins of melanoma cells
   BAMEG_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF1482
Motif
Other DBs
NCBI-ProteinID: ACP16675
Position
692308..692883
Genome map
AA seq 191 aa AA seqDB search
MNTYIYMVRHGESPKLDGGERTRGLTEKGSLDVHKVTDILKTEGIDTFISSPYKRAVLTI
EKTANLYEREILIYENLKECMFSSGDQVISDKEVYPLVQKMFSNPGYALAEGESYADCQR
RVVKVLKEILMDFQGQKIVIGTHGLVMTLMMNYFDKQYGFEFLMNTSKPDIYKMEFKEKQ
LMNVERLWKAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatatatttatatggttagacacggtgaatcaccaaaattagatgggggtgaa
agaacacgtggtttaactgaaaagggaagtttagacgttcataaagtaacagatatatta
aaaacagagggaatcgatactttcatttcaagtccgtataagagggctgtattaacgata
gaaaaaacagctaatctctatgaaagagaaatattaatatatgaaaaccttaaagagtgt
atgttttccagtggggatcaagttatatcagataaagaagtgtatccgcttgtacagaaa
atgttctctaatcctggctatgcactagcggaaggagagtcatatgcggattgccagaga
agagtagtgaaagtgttaaaagaaatattaatggattttcaaggacaaaaaattgtaatt
ggtacacatggtcttgtcatgacattaatgatgaactatttcgataaacaatatggtttt
gaatttttaatgaatacgtcaaaaccagatatatataagatggagtttaaagaaaaacaa
ttaatgaatgtagagagattatggaaagcggaataa

DBGET integrated database retrieval system