KEGG   Bacillus anthracis CDC 684: BAMEG_1985Help
Entry
BAMEG_1985        CDS       T00886                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00473  D-Alanine metabolism
bah00550  Peptidoglycan biosynthesis
bah01100  Metabolic pathways
bah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAMEG_1985 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAMEG_1985 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BAMEG_1985 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bah01011]
    BAMEG_1985 (ddlB)
Enzymes [BR:bah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BAMEG_1985 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bah01011]
 Precursor biosynthesis
  Amino acid ligase
   BAMEG_1985 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A CPSase_L_D2 ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACP12299
UniProt: C3LHM9
Structure
PDB: 

Position
complement(1805455..1806369)
Genome map
AA seq 304 aa AA seqDB search
MRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLAL
HGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMED
LNFDELDKLGFPLVVKPNSGGSSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEI
TCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALK
CSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRK
EEGF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcgttattatgggaggagtatcctctgaaaaacaagtatcaattatgact
ggaaacgaaatgattgcaaatttagataaaaataaatatgaaatcgtaccaattacgtta
aatgaaaaaatggatttaatcgaaaaagcgaaagacattgattttgcgctgctcgcatta
cacggaaaatacggagaagatgggacagttcaaggaacgcttgaaagtttaggtattcct
tatagcggcagcaatatgttatctagcggtatatgtatggacaaaaatatttcgaaaaag
attttacgttatgaaggaatagaaacgccagattggattgaacttacaaaaatggaggat
ttgaattttgatgagttagataagttaggatttccattagtggtaaaaccaaactctggt
ggttcaagtgttggggtaaagattgtctatgataaagacgaattaatttcaatgctggaa
actgtgttcgaatgggattctgaagtagtaatagagaaatatataaaaggtgaagagatt
acatgttccatttttgatgggaaacagttacctatcatttcaattcggcatgcggctgag
ttctttgattacaatgcgaaatatgatgacgctagtacaattgaagaagttatcgaactt
ccagctgaacttaaggaacgtgtaaacaaagcatcactggcgtgctataaagcattaaaa
tgtagtgtttatgcaagggttgatatgatggtgaaggacggtattccatatgtaatggag
gttaatacattaccagggatgacacaagcaagtttactaccaaaaagtgcagatgcagcg
ggaattcattatagtaaactattagatatgattattgaaacttcattaagagtaagaaaa
gaagaagggttttaa

DBGET integrated database retrieval system