KEGG   Bacillus anthracis CDC 684: BAMEG_2009Help
Entry
BAMEG_2009        CDS       T00886                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00010  Glycolysis / Gluconeogenesis
bah00071  Fatty acid degradation
bah00350  Tyrosine metabolism
bah00625  Chloroalkane and chloroalkene degradation
bah00626  Naphthalene degradation
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMEG_2009
  Lipid metabolism
   00071 Fatty acid degradation
    BAMEG_2009
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAMEG_2009
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAMEG_2009
   00626 Naphthalene degradation
    BAMEG_2009
Enzymes [BR:bah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAMEG_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C Flag1_repress
Motif
Other DBs
NCBI-ProteinID: ACP14692
Position
complement(1827099..1828025)
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKCLKWKTCKIKSIQDDEIIVKTIAGAISIGAELPQFKGSDVTDMNPIYP
RKTGYESYGEVIQVGNKVTNLKVGDRVVSFYGHDTIGIVKGDKVIRVPSYIEPKDALLSI
LSCDAAKGILKLNPRQNEKILITGMGVIGLLACYFLKYYVGVKHVDVVEPNKNRRDFAKK
FCAKNIYESEEQIKEAFHYGFECSATNSGFHTLQKALKTNGQICILSDGNIEELTLTADF
YQKELQIIGSSDGYDYQKHADWFFSQIEQTPWIEEIFQHEIQYTELIQCFEELNQGIITP
LKVFVSYK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaatgccttaagtggaaaacgtgtaaa
ataaagtctatacaggatgatgaaattatcgttaaaacaattgcaggggcaataagtatt
ggagcagagttaccgcagtttaaaggatccgatgttacagatatgaatcctatttatcca
agaaaaactggatatgaaagttatggtgaggttattcaagttgggaataaagtaacaaat
ttaaaagtaggtgatagggtagtttctttttatggacatgatacgataggaatagttaaa
ggggataaagtaattcgagtgcctagttatatagaacctaaagatgccttattatctatt
ctttcgtgtgatgctgctaaaggcatattgaaactaaacccacgacagaatgaaaagata
cttataactggaatgggagttataggtttacttgcttgttatttcttaaaatactatgta
ggtgttaagcatgtagatgttgtcgaacctaataaaaatagaagagattttgcaaagaag
ttttgtgcaaaaaacatatatgaatcagaagaacaaataaaagaagcatttcattacggt
ttcgaatgttctgctacaaatagcggatttcatacattacaaaaagcacttaaaactaat
ggacaaatatgtatactttctgatggtaatattgaagaattaacattaaccgccgatttt
tatcagaaagaattgcaaatcattggttcaagtgatgggtatgattatcaaaaacatgca
gattggttttttagtcaaatagaacaaacaccatggatagaagagatttttcaacatgaa
atacaatatacagaactcattcaatgttttgaggaattaaatcaaggaataattacccct
ttaaaagtatttgtctcatataaataa

DBGET integrated database retrieval system