KEGG   Bacillus anthracis CDC 684: BAMEG_2515Help
Entry
BAMEG_2515        CDS       T00886                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00010  Glycolysis / Gluconeogenesis
bah00260  Glycine, serine and threonine metabolism
bah00680  Methane metabolism
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01200  Carbon metabolism
bah01230  Biosynthesis of amino acids
Module
bah_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bah_M00002  Glycolysis, core module involving three-carbon compounds
bah_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMEG_2515
  Energy metabolism
   00680 Methane metabolism
    BAMEG_2515
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAMEG_2515
Enzymes [BR:bah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAMEG_2515
Membrane trafficking [BR:bah04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BAMEG_2515
Exosome [BR:bah04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAMEG_2515
  Exosomal proteins of melanoma cells
   BAMEG_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACP14800
Position
complement(2293758..2294348)
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKTVHFINDTNHLHGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgactttgaattaacagaaaagggaagacagcaagtgcaaagacttgtacag
aaagtgaaagcagattttccaccagatttcatttgggcaagtacattaaaacgcgctcga
gaaactggtgaaacgttagcagaaggaattgggtgcccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtgacggagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaatgggagatacgggaataagcttaattgaaattgacggtgaa
caaaaaacggtacatttcattaatgatacgaatcatttgcacgggatgtag

DBGET integrated database retrieval system