KEGG   Bacillus anthracis CDC 684: BAMEG_3323Help
Entry
BAMEG_3323        CDS       T00886                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00020  Citrate cycle (TCA cycle)
bah00310  Lysine degradation
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01200  Carbon metabolism
Module
bah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAMEG_3323 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BAMEG_3323 (odhB)
Enzymes [BR:bah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BAMEG_3323 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Orai-1
Motif
Other DBs
NCBI-ProteinID: ACP13745
Position
3014705..3015961
Genome map
AA seq 418 aa AA seqDB search
MIEIKVPELAESITEGTISQWLLNVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAEQSKQETAEAPKAAAPSAEQTATLQGLPNT
NRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPVA
KTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKH
DVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDAN
QLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGM
HKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttctcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagacgcaaacggagca
ccagttgcagtaagtacacctgcaccggctgagcaatcgaaacaagaaacagctgaagca
ccaaaagctgcggcaccaagtgctgaacaaactgcaactctacaaggtttaccaaataca
aaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgactta
aacgacgtacgtagcacagatccacttggccgtgtgagaccacacgatgtacaagctcat
gctgcagcaccaaaagaagcaccagctgctccaaaaagtccagctcctgctccagttgca
aaaactgaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaatt
gcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaagtt
gatatgactgcaatcatggaattacgtaaagagcgtaaagatgctttcgagaaaaaacat
gatgtacgtcttggtttcatgtcattcttcacaaaagcagttgttgcagcattaaaacaa
ttcccattattaaatgctgaaattcaaggcgacgagcttatcattaaaaaattctatgat
atcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgcgaac
caattaaacttcgctgaaatcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgat
aacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggtgtg
ttcggttctctaatgtcaacaccgatcctaaacagcccacaagttggtattttaggaatg
cacaaaatccaagtacgtccagttgcaatcgataacgaacgtatggaaaaccgcccaatg
atgtacatcgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagcttc
cttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system