KEGG   Bacillus anthracis CDC 684: BAMEG_4271Help
Entry
BAMEG_4271        CDS       T00886                                 

Definition
(GenBank) alpha-amylase
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00500  Starch and sucrose metabolism
bah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BAMEG_4271
Enzymes [BR:bah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     BAMEG_4271
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     BAMEG_4271
    3.2.1.135  neopullulanase
     BAMEG_4271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_N Malt_amylase_C GHL6 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ACP16590
Position
3873362..3875122
Genome map
AA seq 586 aa AA seqDB search
MLKEAIYHRPKDNYAYAYDEKTIHIRIRTKRDDVQSTTLIYGDPYEWKDGKWISSSTPMK
KTGSTALFDYWFISIEPKFKRLRYGFELKNDTDTLIYAERGFFSTTPNDDVGNFFCFPFI
HANDVFKAPSWIKDTVWYQIFPERFANGDHTLNPENTLPWGSAEPTPTNFFGGDFAGIIQ
NLDYLVKLGISGIYFTPIFKAHSNHKYDTIDYMEIDPQFGTKETFKELVQACHTHGIKVM
LDAVFNHSGYFFDKFQDVLQNGEQSAYKEWFHIHEFPIRTEPLPNYDTFAFTPYMPKLNT
AHPDVKEYLLEVGRYWVREFNIDGWRLDVANEVDHNFWREFRSEIKALNSEVYILGEIWH
DALPWLQGDQFDAVMSYPVTNALLSYFANDSIKANEFMKQITESLHSYSMNVNEAAFHLL
DSHDTPRILTTCNGDKNKLKLLYVFHLSFIGSPCIYYGDEIGMDGGMDPDCRKCMVWDTE
EQDHTLFTHVQTLISLRKQYKAFGGHGTFQFIEANDEYNYISYTKTYEDETIFFVLNPTN
SDITASLPLHVTGKKIINIYTNEEFSAEASVLQVTLPPYGFSILKW
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagaagccatttatcataggccaaaagataattacgcatacgcttacgatgaa
aaaacgattcacatccgaatacgtacgaaaagagacgatgttcaaagcaccactcttatt
tatggtgatccttatgaatggaaagacgggaagtggatttcttcaagtacaccgatgaaa
aaaactggttctactgcattgtttgattattggttcatttccatcgagccgaaatttaag
cgcttacgttatggatttgaattaaaaaacgatacagacactcttatttatgcagagcga
ggatttttttctaccactccaaatgatgacgttggtaactttttctgttttccatttatt
catgcaaatgatgtattcaaagcaccttcttggattaaagatactgtttggtatcaaatt
ttcccagaacggttcgctaatggagatcatacgctgaatccagaaaacacccttccttgg
ggcagcgctgagccaactccaactaattttttcggtggagattttgctggtattattcaa
aaccttgattaccttgttaagcttggaatttcaggaatatatttcacacctattttcaaa
gcacattcaaaccataaatatgacacaattgactacatggaaatcgatccacaatttggt
acaaaagaaacattcaaagaactcgttcaggcatgtcatacacacggtataaaagtaatg
ctcgatgctgtattcaatcacagtggatactttttcgataaatttcaagacgtactacaa
aatggtgagcagtcagcatataaagaatggttccatattcatgagttcccaattagaact
gagccactcccgaattatgatactttcgcgtttacaccgtatatgccgaaattaaacaca
gcgcacccggatgtaaaagaatacttacttgaagtagggcgttattgggtgagagaattc
aatatagacggttggcgccttgatgtagcaaatgaagtcgaccataacttttggagagaa
tttcgaagtgagataaaagcattaaattctgaagtatatattttaggagaaatttggcac
gatgcacttccatggctacaaggagatcaattcgatgctgtcatgagctatcctgttaca
aacgccctactgtcttactttgctaacgattccattaaggcaaatgaatttatgaaacaa
attacagaatctctacattcctactctatgaatgtaaatgaagcagcatttcatttatta
gatagccatgatacaccaagaattttgacaacatgtaacggagataaaaataagttaaaa
ttactttatgtattccatctttctttcatcggctctccttgtatttattatggagacgaa
attggtatggacggcggtatggacccagattgtcgcaaatgtatggtttgggatacggaa
gaacaagatcatacattatttacacatgtacaaacattaatttcattacgaaagcaatat
aaagcatttggaggacatggtactttccaattcattgaagcaaatgatgaatataattat
atttcttatacgaaaacatatgaagatgaaacgatctttttcgttttaaatccgactaat
agtgatattacagcttcactccctctccatgttactggaaagaaaatcattaatatttat
acaaacgaagaattttcagcggaagcaagtgtattacaagttacacttcctccatatgga
ttctccatattaaaatggtaa

DBGET integrated database retrieval system