KEGG   Bacillus anthracis CDC 684: BAMEG_4280Help
Entry
BAMEG_4280        CDS       T00886                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00071  Fatty acid degradation
bah00072  Synthesis and degradation of ketone bodies
bah00280  Valine, leucine and isoleucine degradation
bah00310  Lysine degradation
bah00362  Benzoate degradation
bah00380  Tryptophan metabolism
bah00620  Pyruvate metabolism
bah00630  Glyoxylate and dicarboxylate metabolism
bah00640  Propanoate metabolism
bah00650  Butanoate metabolism
bah00900  Terpenoid backbone biosynthesis
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01200  Carbon metabolism
bah01212  Fatty acid metabolism
bah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAMEG_4280
   00630 Glyoxylate and dicarboxylate metabolism
    BAMEG_4280
   00640 Propanoate metabolism
    BAMEG_4280
   00650 Butanoate metabolism
    BAMEG_4280
  Lipid metabolism
   00071 Fatty acid degradation
    BAMEG_4280
   00072 Synthesis and degradation of ketone bodies
    BAMEG_4280
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAMEG_4280
   00310 Lysine degradation
    BAMEG_4280
   00380 Tryptophan metabolism
    BAMEG_4280
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAMEG_4280
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAMEG_4280
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAMEG_4280
Enzymes [BR:bah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAMEG_4280
Exosome [BR:bah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAMEG_4280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACP15351
Structure
PDB: 

Position
complement(3882681..3883856)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatggggattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaatggt
agtggtgtaggacttggacatccaattggttgtacaggagctcgtattactgtaagttta
attcatgaattaaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggagtagcattatttatagaagcactataa

DBGET integrated database retrieval system