KEGG   Bacillus anthracis A0248: BAA_0570
Entry
BAA_0570          CDS       T00892                                 

Symbol
pfl
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00620  Pyruvate metabolism
bai00640  Propanoate metabolism
bai00650  Butanoate metabolism
bai01100  Metabolic pathways
bai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAA_0570 (pfl)
   00640 Propanoate metabolism
    BAA_0570 (pfl)
   00650 Butanoate metabolism
    BAA_0570 (pfl)
Enzymes [BR:bai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BAA_0570 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACQ47629
Position
503501..505750
AA seq 749 aa
MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLAGATEATKQLWDQVMD
LTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDKPFKRSLQPYGGIRMAE
QACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKSGVITGLPDAYGRGRIIG
DYRRVALYGVDHLIEAKKADLNLTGGVMSEDTMRLREELSEQIRALQELKQMAASHGFDI
SKPATNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDIYIERDLANGTLTEEDVQEI
VDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALDGRPLVTKNSFRFLHTLDNLG
PAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYENDDIMRADYGDDYGIACCVSAMRI
GKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYAPITSEVLDYEEVMHKFDMTMEW
LAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTMATGIAGLSVVADSLSAIKYAKVK
PIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLVKTFMNKLRKHKTYRNSVHTMSILT
ITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRDTKGALASLLSVAKLPYEDAQDGISN
TFSIIPKALGKEDEVQVRNLVSMLDGYAVKEGHHLNINVFNRETLMDAMEHPEKYPQLTI
RVSGYAVNFIKLTREQQIDVINRTMHESM
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgactcaagtattagaaaatgttaaaaacgcatgggaaaactttaaaggtgaaaaatgg
aaagcagagattgatgttcgcgatttcattttaaataatgtaaacgtttacgagggagat
gaatctttcttagcgggagcaactgaagcaacgaaacaactttgggatcaagtaatggat
ttaacaacgaaagaacgtgaaaacggtggcgttcttgatatggatacaaaaattgtttct
tctattacatcacatgaaccaggatatttaaataaagagactgaaaaagtagtcggtttc
caaactgataaaccatttaaacgttctttacagccatatggtggtattcgtatggcggaa
caagcttgtgaatcttatggatacgaaatggataaagaacttagtcgtatttttagagat
tggagaaaaactcataaccaaggtgtatttgatgcttatacaccagaaatgagagctgct
cgtaaatcaggtgttattactggtcttccagatgcatacggacgtggacgtattatcggt
gactaccgccgcgtagcattatatggagtagatcatttaattgaagcgaagaaagcagat
ttaaatttaactggcggtgtaatgagtgaagatacaatgcgtttacgcgaagaattatct
gagcaaatacgtgcacttcaagagttaaaacaaatggctgcttctcatggatttgatatt
tctaagccagcaacaaatgctcaagaagcattccaatggttatactttgcatatcttgca
gcaattaaagagcaaaacggagctgcaatgagtcttggacgtacttctacattcttagat
atttatattgaaagagatttagcaaatggtactttaacagaagaagacgtacaagaaatt
gtggatcacttcattatgaaattacgtcttgtgaaatttgccagaacacctgattataat
gagttattctctggtgacccaacttgggtaactgagtctatcggtggtatggcattagat
ggtcgtccattagtaacaaagaactcattccgtttcttgcatacattagataatttagga
ccagctccagaaccaaacttaacagttctttggtctaaacaattaccacagaactttaaa
aactactgtgcgaaaatgtctattaaaacatcagcaattcaatatgaaaatgatgacatt
atgcgtgctgactacggcgatgactacggaattgcttgttgtgtatctgcaatgagaatc
ggtaaacaaatgcaattctttggcgcacgtgcaaacttagcaaaagcattgctatatgcg
attaacggtggtaaagatgaaaaatctaaagcgcaagttggtcctgagtatgcaccgatt
acttctgaagtattagattatgaagaagttatgcataagtttgatatgacaatggaatgg
ttagcgggtctatatttaaacacattaaatgttattcactacatgcacgataaatatagc
tacgaacgtattgaaatggcacttcatgatacaaatgttcttcgtacaatggcaacaggt
atcgcgggtctatctgtagtagcagattctttaagtgcaattaaatatgcaaaagtaaaa
ccaattcgcgatgaaaacggaatcgcagttgactttgaaattgaaggagatttccctaaa
tacggtaacaatgatgaccgtgtagatgaaattgctgtaaatcttgtgaaaacatttatg
aataaacttcgtaaacataaaacatacagaaattctgttcatacaatgtcaatcttaaca
atcacatctaacgttgtatacggtaagaaaactggtaacactccagatggtcgccgtact
ggagaaccatttgcaccaggtgcgaacccaatgcatggacgtgatacaaaaggtgcgcta
gcttcattattatctgtagctaaattaccatatgaagatgcacaagatggtatttctaat
acattctctattattccaaaagcacttggtaaagaggatgaagtacaagtacgtaactta
gtatcaatgcttgatggttatgcagtaaaagaaggacatcacttaaatattaacgtattt
aaccgtgaaacattaatggatgcaatggaacatcctgagaaatatccacaattaacaatt
cgcgtatctggttacgctgtaaactttattaaattaactcgtgaacaacaaatcgatgta
attaaccgtacaatgcatgaaagcatgtaa

DBGET integrated database retrieval system