KEGG   Bacillus anthracis A0248: BAA_2836Help
Entry
BAA_2836          CDS       T00892                                 

Gene name
acoL
Definition
(GenBank) acetoin dehydrogenase complex, dihydrolipoamide dehydrogenase component
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00010  Glycolysis / Gluconeogenesis
bai00020  Citrate cycle (TCA cycle)
bai00260  Glycine, serine and threonine metabolism
bai00280  Valine, leucine and isoleucine degradation
bai00620  Pyruvate metabolism
bai00630  Glyoxylate and dicarboxylate metabolism
bai00640  Propanoate metabolism
bai01100  Metabolic pathways
bai01110  Biosynthesis of secondary metabolites
bai01120  Microbial metabolism in diverse environments
bai01130  Biosynthesis of antibiotics
bai01200  Carbon metabolism
Module
bai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA_2836 (acoL)
   00020 Citrate cycle (TCA cycle)
    BAA_2836 (acoL)
   00620 Pyruvate metabolism
    BAA_2836 (acoL)
   00630 Glyoxylate and dicarboxylate metabolism
    BAA_2836 (acoL)
   00640 Propanoate metabolism
    BAA_2836 (acoL)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAA_2836 (acoL)
   00280 Valine, leucine and isoleucine degradation
    BAA_2836 (acoL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bai04147]
    BAA_2836 (acoL)
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BAA_2836 (acoL)
Exosome [BR:bai04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BAA_2836 (acoL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA NAD_binding_8 FAD_oxidored Pyr_redox_3 HI0933_like AlaDh_PNT_C FAD_binding_2 DAO Lycopene_cycl FAD_binding_3 3HCDH_N NAD_binding_7 Trp_halogenase 2-Hacid_dh_C Thi4 FecR
Motif
Other DBs
NCBI-ProteinID: ACQ47182
Position
complement(2578969..2580348)
Genome map
AA seq 459 aa AA seqDB search
MSKLVVIGGGPAGYVAAITAAQNGKNVTLIDEADLGGTCLNVGCMPTKSLLESAEVHDIV
RKSNHYGVTLNNGSISIDWKQMQVRKSQIVTQLVQGIQYLMKKNKIKVIQGKAKFETDHR
VRVTYGDKEIVVDGEQFIIATGSEPTELPFAPFDGKWILNSTHAMSLKNIPKSLLIVGGG
VIGCEFASIYSRLGTKVTIVEMAPQLLPGEDEDIAHILRGKLENDGVKIFTGATLKGLNS
YKKQALFEYEGGIQEVNPEFVLVSVGRKPRVQQLNLEKAGIQYSNKGISVNEHMQTNVSH
IYAAGDVIGGIQLAHVAFHEGTTAALYASGEDVKVNYHAVPRCIYTAPEIASVGLTEKDA
KEQYGDIQIGEFPFTANGKALIIGEQTGKVKVIVEPKYQEIVGISIIGPRATELIGQGTV
MIHTEVTADIMRDYIAAHPTLSESIHEALLQAVGHAVHA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattagtcgttattggaggcggacctgctggctatgtagcggcaattaccgcg
gctcaaaatggaaaaaatgtcactcttattgatgaagctgatcttggcgggacttgttta
aatgtcgggtgcatgcctacaaaatcattgttagaaagtgcagaagtgcatgacattgtg
agaaaatcgaatcattatggagttacgcttaacaatggaagtatatcaatcgattggaag
caaatgcaggtgagaaaatcgcaaatcgtaacgcagctcgtccaaggaattcaatattta
atgaagaaaaataaaataaaagttatacaaggtaaagcgaaatttgaaacggatcatcgt
gtgagagttacatacggtgataaagaaattgtagtagatggagaacagttcattatagcg
acaggttcagaaccgactgaattaccttttgctccatttgatgggaagtggattttaaat
agtacccatgcaatgtctctaaaaaacataccgaaatcattattaatcgttggcggtggt
gtaatagggtgcgagtttgcaagtatttatagtcgtcttggaacaaaagttacaattgtt
gaaatggcaccgcaattattaccaggtgaagatgaagatatcgcacacattttaagaggg
aaactagaaaatgatggcgtgaaaatatttacaggagcaactttaaaaggattaaatagt
tataagaagcaggctttatttgaatatgaaggaggtatccaagaagttaatccagaattt
gttctcgtttctgtcggccgaaaaccacgtgtacaacaattaaacttagaaaaagcaggc
attcaatattcaaataaaggaatttctgtgaatgaacatatgcaaaccaatgtatcacat
atttacgcagcaggtgatgtgattggtggaatccagcttgctcacgttgcattccatgaa
ggaacgacggcagcattatacgcgagtggagaagatgtaaaagtaaactaccatgctgta
cctcgctgtatttataccgctccagaaattgctagcgtcggtttaacagaaaaagatgca
aaagagcagtacggtgacatacaaattggcgaatttccttttacagcgaatggaaaagcg
cttattattggagaacaaacggggaaagtaaaagttattgtggaacctaaatatcaagaa
attgttggaatttctattattggtcctcgcgcaacagaactaattggtcaaggaactgta
atgattcatacggaagttaccgctgatattatgagagattatattgcagcgcatccaact
ttatctgaatcgattcatgaagctttattgcaagctgtagggcatgctgtacatgcttaa

DBGET integrated database retrieval system