KEGG   Bacillus anthracis A0248: BAA_2838Help
Entry
BAA_2838          CDS       T00892                                 

Gene name
acoB
Definition
(GenBank) TPP-dependent acetoin dehydrogenase E1 beta-subunit
  KO
K21417  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta [EC:1.1.1.-]
Organism
bai  Bacillus anthracis A0248
Brite
KEGG Orthology (KO) [BR:bai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAA_2838 (acoB)
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BAA_2838 (acoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: ACQ49899
Position
complement(2581588..2582622)
Genome map
AA seq 344 aa AA seqDB search
MTRTVSMSTAINEAMKISMRRDENVILIGEDVAGGAQVDHLQDDEAWGGVLGVTKGLVQE
FGRNRILDTPISEAGYMGAAMAAAATGLRPIAELMFNDFIGSCLDQVLNQGAKFRYMFGG
KAKVPVTVRTMHGAGFSAAAQHSQSLYALFTSIPGIKVVVPSTPYDAKGLLLAAIEDDDP
VIFFEDKTLYNMKGEVPEGYYTIPLGKADIKREGSDVTIVAIGKQVHTALAAAEQLAKKG
LEVEVIDPRSLSPLDEDTILSSVEKTNRLIVIDEANPRCSIATDIAAIVADRGFDLLDAP
IKRITAPHTPVPFSPPLEKLYLPTPEKVIETVSEMIGDQSLLHV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgactagaacagtaagtatgtcaactgcaattaatgaagcgatgaaaatctcaatgcgt
cgtgatgaaaacgtaattttaataggagaagatgttgcaggtggtgcacaagttgatcat
ttgcaagatgatgaagcatggggcggtgttcttggtgttacgaaaggccttgtacaagaa
tttggccgaaatcgtattttagatacaccaatttcagaagcgggttacatgggagcagca
atggcagctgcggcaacaggactacgtccgattgctgaattaatgtttaatgattttatc
ggtagttgtcttgatcaagtattaaaccaaggtgcaaagttccgctatatgttcggtggt
aaagcgaaagtgccagttacagtacgtacgatgcatggtgcaggttttagcgcagctgca
caacattcacaaagtttgtatgcgttatttacgagcattccaggtataaaagttgtcgtt
ccttctactccatatgacgcaaaaggcttactattagcggcaattgaagatgatgatccg
gtaatcttctttgaagataaaacactctacaatatgaaaggtgaagtgccggaagggtat
tatacaattccattaggtaaagcagatattaaacgagaaggttctgatgtaacaatcgtc
gccattggaaaacaagttcatacagcacttgcggctgctgagcaattagcgaaaaaagga
cttgaagtagaagtgattgatccgcgttctttatcaccacttgatgaagatacaatctta
tcatctgttgaaaaaacgaatcgactgattgttattgatgaagcaaaccctagatgtagc
attgcgacagatattgcagcaattgtagcggatagaggatttgatttattagatgcacct
attaaacgaattacagcaccacatacaccagttccgttctcaccaccacttgaaaagtta
tatttaccaacgccggagaaagtaattgaaactgtatcagaaatgatcggagaccaatct
ttattacatgtgtaa

DBGET integrated database retrieval system