KEGG   Bacillus anthracis A0248: BAA_2841Help
Entry
BAA_2841          CDS       T00892                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB_2 DUF664 DUF1572 DinB
Motif
Other DBs
NCBI-ProteinID: ACQ46529
Position
complement(2583808..2584287)
Genome map
AA seq 159 aa AA seqDB search
MAHVKDVLADQLLANANDPSWYIPFSDAVKDLSEREAFWKPNEESNSIAEIVQHLLYWNS
TWQTRYKESNVNAVPAIGDNNKSFMLSNNQTFDELREKLLEKLLQWQKLINEEKVESDVV
GFPVCAKWWEVLANVTTHNAYHIGQIIYIRKLQKSFDNE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgtgaaggatgtattagcagatcagttattagcgaatgcgaacgatcctagt
tggtatattccgttttcagatgcagtgaaagatctatctgagagggaagctttctggaaa
ccgaatgaagagagtaatagtatagctgaaattgtacaacatttactgtattggaactca
acgtggcaaactaggtacaaagaatcgaatgtgaatgccgtgcccgctattggtgataat
aacaaaagttttatgctttcaaataatcaaaccttcgatgagttaagagaaaaactacta
gagaaactattacaatggcaaaagcttatcaatgaagagaaggttgaaagtgatgtagtt
ggatttccagtatgtgcgaagtggtgggaagtgctagcaaatgtaacaactcataatgct
tatcatattggtcaaattatttacattcggaagttacagaagagttttgataatgaataa

DBGET integrated database retrieval system