KEGG   Bacillus anthracis A0248: BAA_2842Help
Entry
BAA_2842          CDS       T00892                                 

Definition
(GenBank) oxidoreductase, short-chain dehydrogenase/reductase family
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Epimerase Eno-Rase_NADH_b NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACQ47104
Position
2584446..2585321
Genome map
AA seq 291 aa AA seqDB search
MIKEKESWQKMNKKVAIITGASSGFGLLTTLELAKKDYLIIATMRNLEKQANLISQATQL
NLQQNITVQQLDVTDQNSIHNFQLYIKEINRVDLLINNAGYANGGFVEEIPVEEYRKQFE
TNLFGAISITQLVLPYMREQKSGKIINISSISGQVGFPGLSPYVSSKYALEGWSESLRLE
VKSFGIDVALIEPGSYNTNIWEVGKQLAENQSETTSPYKEYMGKIQKHINSGSDRFGNPI
DVAKKIVDIAEAKRTTLRYPIGKGVKFMILARKILPWRLWEYLVLRSFKKM
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagaaaaagaaagctggcagaaaatgaacaaaaaagtcgcaattattacagga
gcctcaagtggatttggactattaactacactcgaactcgcaaaaaaagattatttaatt
atcgctacaatgcgaaaccttgaaaaacaagcgaacttaatatctcaagctactcaactc
aacttgcagcaaaacataacagttcaacaattagatgtaaccgatcaaaactctatacat
aactttcaattatatataaaagaaataaatagagtagatctacttattaataacgcagga
tatgcaaatgggggctttgtagaagaaattccagtagaagaataccgtaaacaatttgaa
acgaatctttttggtgctatttcaatcactcagcttgttttaccatatatgagagaacaa
aaaagcggaaaaatcattaatataagtagcattagtggtcaagttggattccctggttta
tccccttacgtttcttccaaatatgcattagaaggatggagtgaatcccttcgtttagaa
gtgaaatcttttggaatagatgttgctttaattgaaccaggttcttataacacgaacatt
tgggaagttggtaaacaattagcagaaaatcaatctgaaactacctctccatacaaagaa
tatatgggtaaaatacaaaaacatattaatagcggcagtgatagatttggtaatccgata
gatgttgctaaaaaaatcgttgatattgctgaagctaagcgcacaacattacgataccca
attggaaaaggtgtaaaatttatgatcttagcaagaaaaattcttccttggagattgtgg
gaatatcttgttttgagaagctttaagaaaatgtaa

DBGET integrated database retrieval system