KEGG   Bacillus anthracis A0248: BAA_2844Help
Entry
BAA_2844          CDS       T00892                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4181 DUF3149
Motif
Other DBs
NCBI-ProteinID: ACQ50012
Position
complement(2585949..2586329)
Genome map
AA seq 126 aa AA seqDB search
MDTSTILIIIIGLGIGGYFLEQFLRRKLNMEKRGFFGYKHVNSLHVKLEIGLIIIYVVSS
CYYMFKFENAKMAYVMFTYLGISWTLRAWMEWKYDRKSKEYILSITGMVSFILMLSILFY
FVPPAV
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatacctctacaattttaattattattattggactgggtataggtggttacttttta
gaacagtttttaagaagaaaattaaatatggagaaaagaggcttctttggatataagcat
gtgaatagtttacatgtaaaattagaaataggtcttattattatttatgtagtaagtagt
tgttattatatgtttaaatttgaaaacgctaaaatggcttatgtcatgttcacttattta
gggatatcatggactttaagagcatggatggaatggaaatatgatagaaaatcaaaagaa
tatatactttcgataacgggaatggtttcttttatattgatgctctcgatactattttat
ttcgttccacctgctgtataa

DBGET integrated database retrieval system