KEGG   Bacillus anthracis A0248: BAA_2846Help
Entry
BAA_2846          CDS       T00892                                 

Definition
(GenBank) hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C_2 SpoIIE DUF1409
Motif
Other DBs
NCBI-ProteinID: ACQ46359
Position
complement(2587210..2588034)
Genome map
AA seq 274 aa AA seqDB search
MHTTNNRQCSWVGNKKMCLDEVSVKQYGDIVLGTYGGNISAGAKKNEDGALVWSNGDWEF
AAILDGHNSAESVDLVVNTIQKEYENIKVMMNESIDTVFRSVENHLLTIFQSPSFKGKCK
RVKGETVCLLCVRKENYIWWLSIGDCLVYVFHEELHKLGQYALNQRHFYEWIGNVNTFDL
SVPCYSRGIRELRTGKNRIVMVTDGVLECGERHYETPLNLYNDMNRNDIELEESVHHVLE
HVHHQFGRDSATIISWDVENKRNTTYPSDQPEKR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaacaaataatagacaatgttcatgggttggaaataagaagatgtgtttagat
gaagtttcagtaaaacaatatggtgatatcgtacttggtacatatggcgggaatataagc
gccggagcaaaaaagaacgaagatggcgcgttagtttggtcaaatggtgattgggaattt
gcagctattttagatggacataatagtgcggaaagtgttgatttagtagtaaatacaatc
caaaaagaatatgaaaatataaaagtaatgatgaatgaatcgattgatacagtatttcga
tctgttgaaaatcatctacttacaatctttcaatccccctcatttaaaggaaagtgcaaa
agagtaaaaggtgaaacagtttgcttactatgtgtaagaaaagaaaactacatatggtgg
ttatctattggcgattgcttagtttatgtatttcatgaagagttacataagttaggacaa
tatgcattaaatcaacgtcacttttacgaatggattggaaatgtaaatacctttgattta
tctgtaccttgctactcaagaggaattcgtgaattacgtactggaaaaaatcgaattgtc
atggttacagatggggtattagaatgcggggaacgacactatgaaacaccattaaatctg
tataatgatatgaatagaaatgatatagaactggaagaaagtgttcatcatgtattagag
cacgttcatcatcaattcggacgagacagtgcgacaattattagttgggatgttgaaaat
aaaagaaatactacgtatccgagtgatcagccggagaaaagataa

DBGET integrated database retrieval system