KEGG   Bacillus anthracis A0248: BAA_2848Help
Entry
BAA_2848          CDS       T00892                                 

Definition
(GenBank) glycine betaine/L-proline ABC transporter, permease protein
  KO
K02001  glycine betaine/proline transport system permease protein
Organism
bai  Bacillus anthracis A0248
Pathway
bai02010  ABC transporters
Module
bai_M00208  Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:bai00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BAA_2848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bai02000]
    BAA_2848
Transporters [BR:bai02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    BAA_2848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACQ47309
Position
complement(2588793..2589629)
Genome map
AA seq 278 aa AA seqDB search
MNSIPRIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLIIIPAILMIILLCF
LIWYTTRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNE
RFSKFLKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVP
EDLIEAANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDV
YRSVTQVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtattccgcgtattccattaggggaatgggttgattcatttgttgcaagttta
tatgagcactttgaaggcttattccgaggattctcttatattattggaggattcgttgat
ttactcactaattttttaataataataccggccatattgatgattattttactgtgtttc
ctaatttggtacacaacgagaaaagtatctttagttatttttacactgatcggattatta
tttattttaaatattaactactgggcacagacgatgcaaacattagcactcgtacttact
tccgttattatttcaattattgttggaattccaattgggatattagcatctcaaaatgag
cgtttctcaaaatttttaaaaccgacattagattttatgcagacaatgccggctttcgta
tatctgattcctgcgattacatttttcggagtaggagtagtacctgggattattgcatca
gtaatctttgcaatgccaccgacaattcgttttactgatttaggaattagacaagttcca
gaagatttaatagaagcagcgaatgcatttggttcaaccgcatcacaaaaactatttaaa
gtacaattaccactcgcaactggaacgattatggctggtgtgaatcaaagcattatgctt
tcgttatcaatggtagtaacagcatctcttgtaggagcaccaggtctcggcgttgatgta
taccgttcagtaacacaagttaatatcggaatgggatttgaagccggactagctattgtt
gtcattgcgattatattagaccgcattacacaaggatttcatcaaaaaagaagataa

DBGET integrated database retrieval system