KEGG   Bacillus anthracis A0248: BAA_2867Help
Entry
BAA_2867          CDS       T00892                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3006
Motif
Other DBs
NCBI-ProteinID: ACQ46654
Position
2602327..2602539
Genome map
AA seq 70 aa AA seqDB search
MKRGIIDRFEGELAVIEVNNVTIDVPKSKLPSTAKEGDVLIIEDDTYTIDKDETDKRRRE
IQDLMNKLFE
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaggtattattgaccgttttgaaggcgaactagcagttattgaagtgaataac
gtaacaattgatgtacctaaatccaaactcccttccactgcaaaagagggtgatgttctt
ataatagaggatgatacgtatacgattgataaggacgaaacagataaaagaagacgtgaa
atacaagatttaatgaataagctatttgaatag

DBGET integrated database retrieval system