KEGG   Bacillus anthracis A0248: BAA_2890Help
Entry
BAA_2890          CDS       T00892                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_9 DUF3749 Acetyltransf_CG
Motif
Other DBs
NCBI-ProteinID: ACQ49603
Position
complement(2623634..2624137)
Genome map
AA seq 167 aa AA seqDB search
MQNLVIEEIKQIKDDVEELSNLLKTVVDDGASIGFLPPLEQKESIKYWQTVIVPEVILYV
AKINNQLAGSIQLHLVTKPNGIHRAEICKLMTHPNFRRNGIGRLLMQKAEERAKQENRSL
LVLDTREGDPSNRLYKSLDYQEVGKIPEYAISPNGNLDATVIYYKFL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttagtaattgaagagattaagcaaataaaagatgatgtggaagagctttct
aaccttttgaaaacggttgtagatgatggagcgtcaattggttttttacctccactggaa
caaaaagaatcaataaagtattggcaaactgttatagtgccagaagtgatcttatatgtc
gctaaaataaacaatcaattggcagggagtattcaattacatttagttacaaagcctaac
ggaattcatagagccgagatttgtaagttaatgactcatccaaactttagacgtaatggt
attggacgtttacttatgcaaaaagcagaggaacgagcgaagcaagaaaataggtctctt
ttagtgctagatacgagagaaggagacccttccaacagattgtataaatcattagactat
caagaagttggaaaaataccagaatacgcaatatctccaaatggtaatttagatgccaca
gttatttattataaatttttataa

DBGET integrated database retrieval system