KEGG   Bacillus anthracis A0248: BAA_2928Help
Entry
BAA_2928          CDS       T00892                                 

Definition
(GenBank) glycosyl transferase, WecB/TagA/CpsF family
  KO
K05946  N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [EC:2.4.1.187]
Organism
bai  Bacillus anthracis A0248
Brite
KEGG Orthology (KO) [BR:bai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bai01003]
    BAA_2928
Enzymes [BR:bai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.187  N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase
     BAA_2928
Glycosyltransferases [BR:bai01003]
 Polysaccharide
  Bacterial polysaccharide
   BAA_2928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_WecB Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ACQ50204
Position
complement(2658475..2659227)
Genome map
AA seq 250 aa AA seqDB search
MDHQLIKGIPFATLEYAKAISLLKGWLHEKQEKPRFVVTANPEIVMSAKENTAKSKQFKK
ILLSADLITADGIGVIIGSKILKGTLKERVTGADITHDLIKHCNENGCRVFLFGAAPESN
KKALEKLNEQFPGAQFKGQHGFVNGEEIEEVKMKIKQFKPDLLLVGLGSPKQEEFIYENL
QTLNIPLSIGIGGMIDIISGTVKRAPKIMRDTGTEWLYRLLSQPKRIKRQLVLPKFLISV
MVERMKGTSS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtggatcaccaacttataaagggaataccttttgcaactttagaatatgcaaaagctata
agtttattaaaaggttggctacatgaaaaacaagaaaaaccaagatttgtagtaactgca
aatcctgaaattgttatgtctgcaaaggaaaacacggctaaatcaaaacaatttaaaaag
atattactttctgcagatttaataacagcggatggaattggcgtcataattggttcgaaa
atattaaaaggaacgctgaaagaacgcgtcactggggcagatatcactcacgatttaata
aaacattgtaatgaaaatggatgtcgggtctttctttttggagctgctccagaaagtaat
aaaaaggcattagaaaaattaaatgagcagttcccaggagcacagtttaaagggcagcat
ggatttgtaaatggtgaagaaatagaagaagtaaaaatgaaaattaagcaattcaagccg
gacttactgctagtaggactaggctcacccaaacaagaagaattcatttatgaaaatcta
caaacattaaacattccgctatctataggtatcggaggtatgatcgatataatttctggt
actgtaaaaagagcaccgaaaattatgagggatacaggaactgaatggttatatagatta
ctctcacagccgaaaagaataaagagacaactcgtacttccgaaatttttaatttcagtt
atggtagagaggatgaaaggaacatcaagttaa

DBGET integrated database retrieval system