KEGG   Bacillus anthracis A0248: BAA_2933Help
Entry
BAA_2933          CDS       T00892                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Methyltransf_9 Acetyltransf_9 FR47
Motif
Other DBs
NCBI-ProteinID: ACQ46345
Position
2662263..2662694
Genome map
AA seq 143 aa AA seqDB search
MSIHMATSNDLEWINNQYDSIGFVRSDLKRDKVAIITYNNAYAGVGRLVQIDEDTLEMGG
IYILPQFRGLQLAGELVSFLVETAKNLQVSNVYCLPFEELENFYKKYGYTEVDTTKEVVH
PIILEKYNWCLGHYDKHVLLFKL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcatatggctacatctaatgatttagaatggattaataatcaatatgactca
ataggatttgtacgaagtgatttaaaaagagataaagttgcaatcattacatacaacaat
gcgtatgcaggtgttggacgattagtccaaatagatgaagatactttagaaatgggcggg
atttatattctccctcaatttagagggctacaattagccggggaactcgtttcattttta
gtagaaactgcgaagaatttacaagtatcaaatgtatattgtcttccttttgaggaatta
gaaaacttttataagaaatatggctatactgaggtcgatactacgaaagaagttgttcat
ccaattattctagaaaaatataattggtgtttgggtcattatgacaagcatgttttatta
tttaagttgtaa

DBGET integrated database retrieval system