KEGG   Bacillus anthracis A0248: BAA_2934Help
Entry
BAA_2934          CDS       T00892                                 

Definition
(GenBank) conserved domain protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GNAT_acetyltran
Motif
Other DBs
NCBI-ProteinID: ACQ49882
Position
complement(2663230..2663373)
Genome map
AA seq 47 aa AA seqDB search
MTIVSAALILDCLEKGIHPNWDAANTTSAKLGYVFDKAYHTYFVDNR
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
gtgactatagttagtgcagcgctaattttggactgtttagaaaaagggatacatccaaac
tgggatgcagcgaatactacatccgctaaactaggatatgtttttgataaagcgtatcat
acatattttgtggataatagatga

DBGET integrated database retrieval system