KEGG   Bacillus anthracis A0248: BAA_2936Help
Entry
BAA_2936          CDS       T00892                                 

Definition
(GenBank) drug resistance transporter, EmrB/QacA family
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr TRI12 MFS_2 PLN_propep MFS_3
Motif
Other DBs
NCBI-ProteinID: ACQ49146
Position
complement(2664217..2665752)
Genome map
AA seq 511 aa AA seqDB search
MVEKNNKLGFVVAGLLLGILMASMDNTIVVTAMGTIVGDLGGLENFVWVVSAYMVAEMAG
MPIFGKLSDMYGRKRFFIFGLIVFMVGSALCGTAENITQLGIYRAIQGIGGGALVPIAFT
IVFDIFPPEKRGKMGGLFGAVFGLSSIFGPLLGAYITDYISWHWVFYINLPLGVLALIFI
TFFYKESRVHRKQKIDWSGAITLVGAVICLMFALELGGQKYDWDSTFILSLFVGFAILII
SFIFIERKVEEPIISFEMFKQRLFGMSTIIALCYGAAFMSATVYIPLFIQGVYGGSATNS
GLLLLPMMLGSVVTAQLGGFLTTKLSYRNIMIISAVIMLIGLFLLSALTPETSRALLTVY
MIIIGFGVGFSFSVLSMAAIHNFGMEQRGSATSTSNFIRSLGMTLGITIFGMIQRTGFQD
QLEEVFKGMSGGMNTNALGDSRAILSESARSQIPPQILDKIIDALSSSIVQTFMWALVPA
GLAFIFIFFMGNERMVMKKQQKNKKGEISKV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaagaataataagctcggctttgttgtggcgggcttattgctaggtatttta
atggcatcaatggataataccattgtcgtaacagcgatgggaacgattgttggtgactta
ggaggtcttgaaaactttgtatgggtcgtttcggcctatatggtcgcagaaatggcaggt
atgccgattttcggtaaactatcagatatgtatggtagaaagagattctttatttttggt
ttaatcgtctttatggttggttcggcactttgtggtactgctgaaaatattacacagtta
ggtatttatcgtgccattcaaggtattggcggcggggcattagtgccgatcgcgtttaca
atcgtttttgatattttccctcctgaaaagcgcgggaaaatgggtggtttatttggagcg
gtatttggtttatcaagtattttcgggccattacttggcgcatatattacagattacatt
agctggcactgggtattttatattaacttaccgcttggcgttttagcacttatttttatt
acgttcttttataaagaatcaagagttcatagaaagcaaaaaattgattggtctggtgca
attactttagttggtgcagtaatttgtttaatgtttgcgcttgaacttggtggacaaaaa
tatgattgggattctacctttattttaagtttatttgttggatttgctattttaattatt
tcatttatttttattgaacgtaaagtagaagaaccgatcatttcatttgagatgtttaag
cagcgcttattcggaatgagtaccattattgctttatgttacggtgctgcgtttatgtcg
gcaactgtatatattccgttattcattcaaggtgtatacggaggtagtgcaacaaactca
gggttattacttttaccgatgatgttaggatcagttgtaacagcgcagttaggcggattt
ttaacgacgaagcttagctaccgaaacattatgattatttctgcggtcattatgctaatt
ggactatttttattaagcgcattaacgccagaaacaagtcgcgcattattaacagtgtat
atgattattatcggatttggagttggattctcattttctgtactaagtatggcagctatt
cacaactttggtatggagcagcgtggatctgcgacttcaacgagtaatttcattcgttca
ttaggaatgacgcttggtattacaatcttcggaatgattcaaagaactggcttccaagat
caattagaagaagtatttaaagggatgagcgggggaatgaatacaaacgctttaggagat
tcaagagctattctatcagaatcggcaagatctcaaatcccgccgcaaatattagataaa
attattgacgcactttctagctcaattgtccaaacatttatgtgggcattggtaccagct
ggtttagcattcatatttattttctttatggggaatgagcgcatggtaatgaagaaacaa
caaaagaataaaaaaggcgaaatatcaaaagtgtaa

DBGET integrated database retrieval system